SMARCD2 Antibody - BSA Free

Immunohistochemistry: SMARCD2 Antibody [NBP3-35216] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using SMARCD2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: SMARCD2 Antibody [NBP3-35216] - Western blot analysis of lysates from Rat thymus, using SMARCD2 Rabbit pAb at 1:600 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Western Blot: SMARCD2 Antibody [NBP3-35216] - Western blot analysis of lysates from Mouse thymus, using SMARCD2 Rabbit pAb at 1:600 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMARCD2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1).
  
  Sequence:
  RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SMARCD2 Antibody - BSA Free

• 60 kDa BRG-1/Brm-associated factor subunit B
• BAF60B
• BRG1-associated factor 60B
• chromatin remodeling complex BAF60B subunit
• CRACD2
• mammalian chromatin remodeling complex BRG1-associated factor 60B
• PRO2451
• Rsc6p
• SWI/SNF complex 60 kDa subunit B
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
• Swp73-like protein

Background

SMARCD2 is encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCD2