SMARCD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SMARCD2 Antibody [NBP2-56267] - Staining of human cell line MCF7 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMARCD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMARCD2 Recombinant Protein Antigen (NBP2-56267PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMARCD2 Antibody - BSA Free

• 60 kDa BRG-1/Brm-associated factor subunit B
• BAF60B
• BRG1-associated factor 60B
• chromatin remodeling complex BAF60B subunit
• CRACD2
• mammalian chromatin remodeling complex BRG1-associated factor 60B
• PRO2451
• Rsc6p
• SWI/SNF complex 60 kDa subunit B
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
• Swp73-like protein

Background

SMARCD2 is encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCD2