SMARCA1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SMARCA1 Antibody [NBP2-56279] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMARCA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMARCA1 Antibody - BSA Free (NBP2-56279) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMARCA1 Antibody - BSA Free

• ATP-dependent helicase SMARCA1
• DKFZp686D1623
• EC 3.6.1
• EC 3.6.4.-
• FLJ41547
• global transcription activator homologous sequence
• Nucleosome-remodeling factor subunit SNF2L
• NURF140
• probable global transcription activator SNF2L1
• SNF2L
• SNF2L1ISWI
• SNF2LB
• SNF2-like 1
• SNF2LT
• subfamily a, member 1
• sucrose nonfermenting 2-like protein 1
• SWI
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1
• SWI2

Background

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. Member of this family have helicase and ATPase activities that alter chromatin structure to facilitate gene transcription. SMARCA1/SNF2L is a component of the human NURF (nucleosome remodeling factor) involved in the regulation of genes involved in neuronal development. SMARCA1/SNF2L is also a component of the heterodimeric complex CERF [CECR2(cat eye syndrome chromosome region, candidate 2)-containing remodeling factor]. Alternate names for SMARCA1/SNF2L include SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SNF2, SNF2L, SNF2L1, SNF2LB, sucrose nonfermenting 2-like protein 1, NURF140, and ISWI.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCA1