Recombinant Human SMAD6 Protein

Images

 
SDS-Page: Recombinant Human SMAD6 Protein [H00004091-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SMAD6 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_005576) for Human SMAD6

Source: Wheat Germ

Amino Acid Sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR 285-384

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMAD6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMAD6 Protein

  • hSMAD6
  • HsT17432
  • MAD homolog 6
  • MADH6SMAD, mothers against DPP homolog 6 (Drosophila)
  • MADH7
  • mothers against decapentaplegic homolog 6
  • Mothers against decapentaplegic, drosophila, homolog of, 6
  • Mothers against DPP homolog 6
  • SMAD 6
  • SMAD family member 6MAD, mothers against decapentaplegic homolog 6 (Drosophila)
  • SMAD, mothers against DPP homolog 6
  • Smad6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
355-BM/CF
Species: Hu, Mu, Rt
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NBP2-67394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ELISA, ICC
AF7215
Species: Hu, Mu
Applications: IHC, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no publications for SMAD6 Recombinant Protein (H00004091-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no reviews for SMAD6 Recombinant Protein (H00004091-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SMAD6 Recombinant Protein (H00004091-Q01)

Discover related pathways, diseases and genes to SMAD6 Recombinant Protein (H00004091-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMAD6 Recombinant Protein (H00004091-Q01)

Discover more about diseases related to SMAD6 Recombinant Protein (H00004091-Q01).
 

Pathways for SMAD6 Recombinant Protein (H00004091-Q01)

View related products by pathway.

PTMs for SMAD6 Recombinant Protein (H00004091-Q01)

Learn more about PTMs related to SMAD6 Recombinant Protein (H00004091-Q01).
 

Research Areas for SMAD6 Recombinant Protein (H00004091-Q01)

Find related products by research area.

Blogs on SMAD6

There are no specific blogs for SMAD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMAD6 Antibody
NB100-56440

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMAD6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD6