Recombinant Human SMAD6 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SMAD6 Protein [H00004091-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human SMAD6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_005576) for Human SMAD6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMAD6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMAD6 GST (N-Term) Protein

  • hSMAD6
  • HsT17432
  • MAD homolog 6
  • MADH6SMAD, mothers against DPP homolog 6 (Drosophila)
  • MADH7
  • mothers against decapentaplegic homolog 6
  • Mothers against decapentaplegic, drosophila, homolog of, 6
  • Mothers against DPP homolog 6
  • SMAD 6
  • SMAD family member 6MAD, mothers against decapentaplegic homolog 6 (Drosophila)
  • SMAD, mothers against DPP homolog 6
  • Smad6

Background

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
314-BP
Species: Hu
Applications: BA, BA
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67394
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
354-BP
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF7215
Species: Hu, Mu
Applications: ICC, IHC
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
507-BP
Species: Hu
Applications: BA
6057-NG
Species: Hu
Applications: BA
H00004091-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no publications for SMAD6 Recombinant Protein (H00004091-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no reviews for SMAD6 Recombinant Protein (H00004091-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMAD6 Recombinant Protein (H00004091-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMAD6 Products

Research Areas for SMAD6 Recombinant Protein (H00004091-Q01)

Find related products by research area.

Blogs on SMAD6

There are no specific blogs for SMAD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMAD6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD6