Smad3 Antibody (7F3)

Images

 
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in human colon.
Immunohistochemistry-Paraffin: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in HeLa.
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in PC-12.
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in 293.
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in Jurkat.
Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M02), clone 7F3.Lane 1: SMAD3 transfected lysate(48 KDa).Lane 2: ...read more
Proximity Ligation Assay: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 ...read more
Sandwich ELISA: Smad3 Antibody (7F3) [H00004088-M02] - Detection limit for recombinant GST tagged SMAD3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC-P, PLA
Clone
7F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smad3 Antibody (7F3) Summary

Immunogen
SMAD3 (NP_005893, 120 a.a. - 221 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Specificity
SMAD3 - SMAD, mothers against DPP homolog 3 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publication using H00004088-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad3 Antibody (7F3)

  • DKFZp586N0721
  • DKFZp686J10186
  • hMAD-3
  • hSMAD3
  • HsT17436
  • JV15-2MGC60396
  • MAD homolog 3
  • mad protein homolog
  • MAD, mothers against decapentaplegic homolog 3 (Drosophila)
  • MAD, mothers against decapentaplegic homolog 3
  • mad3
  • MADH3mad homolog JV15-2
  • mothers against decapentaplegic homolog 3
  • Mothers against DPP homolog 3
  • SMA- and MAD-related protein 3
  • SMAD 3
  • SMAD family member 3HSPC193
  • SMAD, mothers against DPP homolog 3 (Drosophila)
  • SMAD, mothers against DPP homolog 3
  • Smad3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF3025
Species: Hu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Smad3 Antibody (H00004088-M02)(1)

Reviews for Smad3 Antibody (H00004088-M02) (0)

There are no reviews for Smad3 Antibody (H00004088-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad3 Antibody (H00004088-M02). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you can recommend any primary polyclonal Smad3 antibody (reactivity: human) for gel supershifts?
    • We do provide a wide range of Smad3 antibodies, but unfortunately none of them have been tested for gel shift assay, so we can't guarantee they will work for an application never tested before.

Secondary Antibodies

 

Isotype Controls

Additional Smad3 Products

Bioinformatics Tool for Smad3 Antibody (H00004088-M02)

Discover related pathways, diseases and genes to Smad3 Antibody (H00004088-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad3 Antibody (H00004088-M02)

Discover more about diseases related to Smad3 Antibody (H00004088-M02).
 

Pathways for Smad3 Antibody (H00004088-M02)

View related products by pathway.

PTMs for Smad3 Antibody (H00004088-M02)

Learn more about PTMs related to Smad3 Antibody (H00004088-M02).
 

Research Areas for Smad3 Antibody (H00004088-M02)

Find related products by research area.

Blogs on Smad3

There are no specific blogs for Smad3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad3 Antibody (7F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD3
Entrez
OMIM
Uniprot