Smad3 Antibody (7F3) - Azide and BSA Free

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M02), clone 7F3.Lane 1: SMAD3 transfected lysate(48 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in HeLa.

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in PC-12.

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in 293.

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in Jurkat.

Western Blot: Smad3 Antibody (7F3) [H00004088-M02] - SMAD3 monoclonal antibody (M02), clone 7F3. Analysis of SMAD3 expression in human colon.

Proximity Ligation Assay: Smad3 Antibody (7F3) [H00004088-M02] - Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

ELISA: Smad3 Antibody (7F3) [H00004088-M02] - Detection limit for recombinant GST tagged SMAD3 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, Func, ICC/IF, IHC
• Clone: 7F3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Smad3 Antibody (7F3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
• Specificity: SMAD3 - SMAD, mothers against DPP homolog 3 (Drosophila)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SMAD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad3 Antibody (7F3) - Azide and BSA Free

• DKFZp586N0721
• DKFZp686J10186
• hMAD-3
• hSMAD3
• HsT17436
• JV15-2MGC60396
• MAD homolog 3
• mad protein homolog
• MAD, mothers against decapentaplegic homolog 3 (Drosophila)
• MAD, mothers against decapentaplegic homolog 3
• mad3
• MADH3mad homolog JV15-2
• mothers against decapentaplegic homolog 3
• Mothers against DPP homolog 3
• SMA- and MAD-related protein 3
• SMAD 3
• SMAD family member 3HSPC193
• SMAD, mothers against DPP homolog 3 (Drosophila)
• SMAD, mothers against DPP homolog 3
• Smad3

Background

The protein encoded by the Smad3 gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Smad3 Antibody (H00004088-M02)(1)

Publication using H00004088-M02

• Nagel S, Ehrentraut S, Tomasch J et al. Ectopic Expression of Homeobox Gene NKX2-1 in Diffuse Large B-Cell Lymphoma Is Mediated by Aberrant Chromatin Modifications. PLoS One. 2013-04-29 [PMID: 23637834]

FAQs for Smad3 Antibody (H00004088-M02). (Showing 1 - 1 of 1 FAQ).

1. I was wondering if you can recommend any primary polyclonal Smad3 antibody (reactivity: human) for gel supershifts?
   • We do provide a wide range of Smad3 antibodies, but unfortunately none of them have been tested for gel shift assay, so we can't guarantee they will work for an application never tested before.

Bioinformatics

• Gene Symbol: SMAD3
• Entrez:
  • 4088(Human)
• OMIM:
  • 603109(Human)
• Uniprot:
  • NP_005893(Human)