| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SLX4 Antibody - BSA Free (NBP2-39070) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLX4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
FANCD2 (Fanconi anemia subunit D2 protein) Fanconi anemia (FANC) is a rare, autosomal-recessive genetic disorder that is a heterogeneous cancer susceptibility condition that manifests with a wide range of symptoms such as congenital malformations, deteriorating bone marrow failure, DNA-dama... Read full blog post. |
|
FANCD2: A big component of the DNA repair crew The genetic disorder known as Fanconi anemia (FANC) is a heterogeneous, autosomal-recessive cancer susceptibility condition characterized by a wide array of symptoms. These include congenital malformations, progressive bone marrow failure, DNA-damage ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.