Novus Biologicals products are now on bio-techne.com

SLURP1 Antibody

Images

 
Western Blot: SLURP1 Antibody [H00057152-B01P] - Analysis of SLURP1 expression in transfected 293T cell line by SLURP1 polyclonal antibody. Lane 1: SLURP1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLURP1 Antibody Summary

Immunogen
SLURP1 (NP_065160, 1 a.a. - 103 a.a.) full-length human protein. MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLURP1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This antibody is useful for Western Blot, Functional
Publications
Read Publication using
H00057152-B01P in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLURP1 Antibody

  • ANUPARS(component B)-81/S
  • ARS Component B
  • ArsB
  • ARSlymphocyte antigen 6-like secreted
  • LY6LS
  • MDMsecreted Ly-6/uPAR-related protein 1
  • neoplastic urinary protein
  • secreted LY6/PLAUR domain containing 1
  • secreted Ly6/uPAR related protein 1
  • SLURP1
  • SLURP-1

Background

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
DY417
Species: Mu
Applications: ELISA
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-75563
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
6507-IL/CF
Species: Hu
Applications: BA
H00009242-M01
Species: Hu
Applications: ELISA, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00057152-B01P
Species: Hu
Applications: WB

Publications for SLURP1 Antibody (H00057152-B01P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLURP1 Antibody (H00057152-B01P) (0)

There are no reviews for SLURP1 Antibody (H00057152-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLURP1 Antibody (H00057152-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLURP1 Products

Research Areas for SLURP1 Antibody (H00057152-B01P)

Find related products by research area.

Blogs on SLURP1

There are no specific blogs for SLURP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLURP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLURP1
Uniprot