SLP-76/LCP2 Antibody

Images

 
Western Blot: SLP-76/LCP2 Antibody [NBP1-87033] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEL
Immunohistochemistry-Paraffin: SLP-76/LCP2 Antibody [NBP1-87033] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry: SLP-76/LCP2 Antibody [NBP1-87033] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
Immunohistochemistry-Paraffin: SLP-76/LCP2 Antibody [NBP1-87033] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: SLP-76/LCP2 Antibody [NBP1-87033] - Staining in human lymph node and skeletal muscle tissues using anti-LCP2 antibody. Corresponding LCP2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLP-76/LCP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGE
Specificity
Specificity of human SLP-76/LCP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLP-76/LCP2 Protein (NBP1-87033PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLP-76/LCP2 Antibody

  • LCP2
  • lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of76kDa)
  • lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of76kD)
  • lymphocyte cytosolic protein 2
  • SH2 domain-containing leukocyte protein of 76 kDa
  • SH2 domain-containing leukocyte protein of 76kD
  • SLP-76 tyrosine phosphoprotein
  • SLP76
  • SLP-76
  • SLP7676 kDa tyrosine phosphoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00289
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
NBP2-49097
Species: Hu
Applications: IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4966
Species: Hu
Applications: WB, Simple Western, IHC
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7008
Species: Hu
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for SLP-76/LCP2 Antibody (NBP1-87033) (0)

There are no publications for SLP-76/LCP2 Antibody (NBP1-87033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLP-76/LCP2 Antibody (NBP1-87033) (0)

There are no reviews for SLP-76/LCP2 Antibody (NBP1-87033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLP-76/LCP2 Antibody (NBP1-87033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLP-76/LCP2 Products

Bioinformatics Tool for SLP-76/LCP2 Antibody (NBP1-87033)

Discover related pathways, diseases and genes to SLP-76/LCP2 Antibody (NBP1-87033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLP-76/LCP2 Antibody (NBP1-87033)

Discover more about diseases related to SLP-76/LCP2 Antibody (NBP1-87033).
 

Pathways for SLP-76/LCP2 Antibody (NBP1-87033)

View related products by pathway.

Research Areas for SLP-76/LCP2 Antibody (NBP1-87033)

Find related products by research area.

Blogs on SLP-76/LCP2

There are no specific blogs for SLP-76/LCP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLP-76/LCP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCP2
Entrez