Slit2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Slit2 Antibody [NBP1-80742] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: Slit2 Antibody [NBP1-80742] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: Slit2 Antibody [NBP1-80742] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Slit2 Antibody [NBP1-80742] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Slit2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE
• Predicted Species: Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLIT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Slit2 Protein (NBP1-80742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Slit2 Antibody - BSA Free

• FLJ14420
• SLIL3
• slit (Drosophila) homolog 2
• slit homolog 2 (Drosophila)
• slit homolog 2 protein
• Slit2
• Slit-2SLIL3

Background

Slit proteins are ligands at the Roundabout (Robo) receptors and act as guidance cues in axonal migration/navigation during neural development, at the ventral midline of the neural tube. Slit1 and Slit2 are essential for midline guidance in the forebrain by acting as repulsive signals preventing inappropriate midline crossing by axons projecting from the olfactory bulb. A number of cleavage products are reported in the literature for Slit2 protiens (following alternate splicing). The C-terminal cleavage proteins are more diffusible than the larger N-terminal protein that is more tightly cell associated. Slit2 protein is expressed in fetal lung and kidney, and adult spinal cord. Weak expression in adult adrenal gland, thyroid, trachea.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Slit2 Antibody (NBP1-80742)(5)

Publications using NBP1-80742

• Liu Y, Rittershaus JM, Yu M, Sager R et al. Deletion of POMT2 in Zebrafish Causes Degeneration of Photoreceptors International Journal of Molecular Sciences 2022-11-26 [PMID: 36499139] (ICC/IF, Zebrafish)
• Fang Z, Hu Y, Dai J et al. CS12192, a Novel JAK3/JAK1/TBK1 Inhibitor, Synergistically Enhances the Anti-Inflammation Effect of Methotrexate in a Rat Model of Rheumatoid Arthritis International journal of molecular sciences 2022-11-02 [PMID: 36362183] (IHC-P, Rat)
• Beggs AD, Jones A, Shepherd N et al. Loss of Expression and Promoter Methylation of SLIT2 Are Associated with Sessile Serrated Adenoma Formation. PLoS Genet 2013-05-01 [PMID: 23671423]
• Brantley-Sieders DM, Dunaway CM, Rao M et al. Angiocrine factors modulate tumor proliferation and motility through EphA2 repression of Slit2 tumor suppressor function in endothelium. Cancer Res 2011-02-01 [PMID: 21148069]
• Yu J, Cao Q, Yu J et al. The neuronal repellent SLIT2 is a target for repression by EZH2 in prostate cancer. Oncogene 2010-09-01 [PMID: 20622896]

Bioinformatics

• Gene Symbol: SLIT2
• Entrez:
  • 9353(Human)
• Uniprot:
  • O94813()
  • O94813()
  • O94813()
  • O94813()