Slit2 Antibody

Images

 
Immunohistochemistry-Paraffin: Slit2 Antibody [NBP1-80742] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Slit2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE
Specificity
Specificity of human Slit2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLIT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Slit2 Protein (NBP1-80742PEP)
Publications
Read Publications using NBP1-80742.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23671423).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Slit2 Antibody

  • FLJ14420
  • SLIL3
  • slit (Drosophila) homolog 2
  • slit homolog 2 (Drosophila)
  • slit homolog 2 protein
  • Slit2
  • Slit-2SLIL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3629
Species: Mu
Applications: IHC
AF1749
Species: Rt
Applications: WB, IHC
NBP1-81399
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB110-58780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3076
Species: Hu
Applications: WB, IHC
AF844
Species: Mu
Applications: WB, Block
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87076
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80742
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Slit2 Antibody (NBP1-80742)(3)

Reviews for Slit2 Antibody (NBP1-80742) (0)

There are no reviews for Slit2 Antibody (NBP1-80742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Slit2 Antibody (NBP1-80742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Slit2 Products

Bioinformatics Tool for Slit2 Antibody (NBP1-80742)

Discover related pathways, diseases and genes to Slit2 Antibody (NBP1-80742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slit2 Antibody (NBP1-80742)

Discover more about diseases related to Slit2 Antibody (NBP1-80742).
 

Pathways for Slit2 Antibody (NBP1-80742)

View related products by pathway.

PTMs for Slit2 Antibody (NBP1-80742)

Learn more about PTMs related to Slit2 Antibody (NBP1-80742).
 

Research Areas for Slit2 Antibody (NBP1-80742)

Find related products by research area.

Blogs on Slit2

There are no specific blogs for Slit2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slit2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLIT2
Entrez
Uniprot