SLFN5 Antibody - BSA Free

Western Blot: SLFN5 Antibody [NBP1-81178] - Analysis in human cell lines SK-MEL-30 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

Immunocytochemistry/Immunofluorescence: SLFN5 Antibody [NBP1-81178] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLFN5 Antibody [NBP1-81178] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SLFN5 Antibody [NBP1-81178] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SLFN5 Antibody [NBP1-81178] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: SLFN5 Antibody [NBP1-81178] - Staining of human endometrium shows strong nuclear positivity in glandular cells.A

Simple Western: SLFN5 Antibody [NBP1-81178] - Simple Western lane view shows a specific band for SLFN5 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: SLFN5 Antibody [NBP1-81178] - Electropherogram image(s) of corresponding Simple Western lane view. SLFN5 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLFN5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCRTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLFN5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 92 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  SLFN5 Protein (NBP1-81178PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLFN5 Antibody - BSA Free

• MGC150611
• MGC150612
• MGC19764
• schlafen family member 5

Background

SLFN5 may have a role in hematopoeitic cell differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLFN5 Antibody (NBP1-81178)(2)

Publications using NBP1-81178

• Huang J, Wu C, Kloeber JA et al. SLFN5-mediated chromatin dynamics sculpt higher-order DNA repair topology Molecular cell 2023-02-25 [PMID: 36854302] (WB, ICC/IF, Human)
• Katsoulidis E, Mavrommatis E, Woodard J et al. Role of interferon {alpha} (IFN{alpha})-inducible Schlafen-5 in regulation of anchorage-independent growth and invasion of malignant melanoma cells. J Biol Chem 2010-12-01 [PMID: 20956525]

Bioinformatics

• Gene Symbol: SLFN5
• Entrez:
  • 162394(Human)