SLC7A8 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining in human parathyroid gland and liver tissues using anti-SLC7A8 antibody. Corresponding SLC7A8 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC7A8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
Specificity
Specificity of human SLC7A8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A8 Antibody

  • hLAT2
  • integral membrane protein E16H
  • large neutral amino acids transporter small subunit 2
  • LAT2L-type amino acid transporter 2
  • LPI-PC1
  • solute carrier family 7 (amino acid transporter, L-type), member 8
  • Solute carrier family 7 member 8
  • y+ system), member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-49097
Species: Hu
Applications: IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-64989
Species: Hu
NBP1-82826
Species: Hu
Applications: IHC, IHC-P
NBP2-13336
Species: Hu
Applications: IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22423
Species: Rt
Applications: WB, ICC/IF, IHC, IP

Publications for SLC7A8 Antibody (NBP2-49319) (0)

There are no publications for SLC7A8 Antibody (NBP2-49319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A8 Antibody (NBP2-49319) (0)

There are no reviews for SLC7A8 Antibody (NBP2-49319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A8 Antibody (NBP2-49319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC7A8 Antibody (NBP2-49319)

Discover related pathways, diseases and genes to SLC7A8 Antibody (NBP2-49319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A8 Antibody (NBP2-49319)

Discover more about diseases related to SLC7A8 Antibody (NBP2-49319).
 

Pathways for SLC7A8 Antibody (NBP2-49319)

View related products by pathway.

PTMs for SLC7A8 Antibody (NBP2-49319)

Learn more about PTMs related to SLC7A8 Antibody (NBP2-49319).

Blogs on SLC7A8

There are no specific blogs for SLC7A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A8