SLC7A8 Antibody


Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining in human parathyroid gland and liver tissues using anti-SLC7A8 antibody. Corresponding SLC7A8 RNA-seq data are more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SLC7A8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
Specificity of human SLC7A8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC7A8 Antibody

  • hLAT2
  • integral membrane protein E16H
  • large neutral amino acids transporter small subunit 2
  • LAT2L-type amino acid transporter 2
  • LPI-PC1
  • solute carrier family 7 (amino acid transporter, L-type), member 8
  • Solute carrier family 7 member 8
  • y+ system), member 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow

Publications for SLC7A8 Antibody (NBP2-49319) (0)

There are no publications for SLC7A8 Antibody (NBP2-49319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A8 Antibody (NBP2-49319) (0)

There are no reviews for SLC7A8 Antibody (NBP2-49319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A8 Antibody (NBP2-49319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC7A8 Antibody (NBP2-49319)

Discover related pathways, diseases and genes to SLC7A8 Antibody (NBP2-49319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A8 Antibody (NBP2-49319)

Discover more about diseases related to SLC7A8 Antibody (NBP2-49319).

Pathways for SLC7A8 Antibody (NBP2-49319)

View related products by pathway.

PTMs for SLC7A8 Antibody (NBP2-49319)

Learn more about PTMs related to SLC7A8 Antibody (NBP2-49319).

Blogs on SLC7A8

There are no specific blogs for SLC7A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC7A8 Antibody and receive a gift card or discount.


Gene Symbol SLC7A8