SLC7A2 Antibody

Images

 
Western Blot: SLC7A2 Antibody [NBP1-59872] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC7A2(solute carrier family 7 (cationic amino acid transporter, y+ system), member 2) The peptide sequence was selected from the middle region of SLC7A2 (NP_001008539). Peptide sequence VANWKISEEFLKNISASAREPPSENGTSIYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-59872 in the following applications:

  • WB
    1 publication

Reactivity Notes

Equine reactivity reported in scientific literature (PMID: 29903343).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC7A2 Antibody

  • CAT2
  • CAT-2
  • cationic 2
  • cationic amino acid transporter, y+ system
  • low affinity cationic amino acid transporter 2
  • low-affinity cationic amino acid transporter-2
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
  • Solute carrier family 7 member 2

Background

SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow
NBP1-74138
Species: Hu, Mu, Rt, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
H00009815-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82826
Species: Hu
Applications: WB, IHC, IHC-P
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59872
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB

Publications for SLC7A2 Antibody (NBP1-59872)(1)

We have publications tested in 1 confirmed species: Equine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Equine
(1)
All Species

Reviews for SLC7A2 Antibody (NBP1-59872) (0)

There are no reviews for SLC7A2 Antibody (NBP1-59872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC7A2 Antibody (NBP1-59872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC7A2 Products

Bioinformatics Tool for SLC7A2 Antibody (NBP1-59872)

Discover related pathways, diseases and genes to SLC7A2 Antibody (NBP1-59872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A2 Antibody (NBP1-59872)

Discover more about diseases related to SLC7A2 Antibody (NBP1-59872).
 

Pathways for SLC7A2 Antibody (NBP1-59872)

View related products by pathway.

PTMs for SLC7A2 Antibody (NBP1-59872)

Learn more about PTMs related to SLC7A2 Antibody (NBP1-59872).

Blogs on SLC7A2

There are no specific blogs for SLC7A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A2
Entrez
Uniprot