SLC6A3/DAT1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC6A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SLC6A3/DAT1 Antibody - BSA Free
Background
The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse (Kish et al., 2001; Zhu et al., 2000; Zhu et al., 1999). Levels of DAT protein expression are altered by chronic drug administration (Wilson et al., 1996).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Publications for SLC6A3/DAT1 Antibody (NBP2-68583) (0)
There are no publications for SLC6A3/DAT1 Antibody (NBP2-68583).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC6A3/DAT1 Antibody (NBP2-68583) (0)
There are no reviews for SLC6A3/DAT1 Antibody (NBP2-68583).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SLC6A3/DAT1 Antibody (NBP2-68583). (Showing 1 - 1 of 1 FAQ).
-
Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?
- Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC6A3/DAT1 Products
Research Areas for SLC6A3/DAT1 Antibody (NBP2-68583)
Find related products by research area.
|
Blogs on SLC6A3/DAT1