SLC6A3/DAT1 Antibody

Images

 
Immunohistochemistry: SLC6A3/DAT1 Antibody [NBP2-68583] - Immunohistochemical staining of human caudate nucleus shows strong positivity in synapses and neuronal projections.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC6A3/DAT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SLC6A3/DAT1 Antibody

  • DA transporter
  • DAT1
  • DATDAT1Solute carrier family 6 member 3
  • SLC6A3
  • sodium-dependent dopamine transporter
  • solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
  • VNTR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt, KO
NLS3921
Species: Hu, Mk, Pm
Applications: IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1403
Species: Hu
Applications: IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
NB110-40415
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NB600-534
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA

Publications for SLC6A3/DAT1 Antibody (NBP2-68583) (0)

There are no publications for SLC6A3/DAT1 Antibody (NBP2-68583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A3/DAT1 Antibody (NBP2-68583) (0)

There are no reviews for SLC6A3/DAT1 Antibody (NBP2-68583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC6A3/DAT1 Antibody (NBP2-68583). (Showing 1 - 1 of 1 FAQ).

  1. Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?
    • Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC6A3/DAT1 Products

Bioinformatics Tool for SLC6A3/DAT1 Antibody (NBP2-68583)

Discover related pathways, diseases and genes to SLC6A3/DAT1 Antibody (NBP2-68583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A3/DAT1 Antibody (NBP2-68583)

Discover more about diseases related to SLC6A3/DAT1 Antibody (NBP2-68583).
 

Pathways for SLC6A3/DAT1 Antibody (NBP2-68583)

View related products by pathway.

PTMs for SLC6A3/DAT1 Antibody (NBP2-68583)

Learn more about PTMs related to SLC6A3/DAT1 Antibody (NBP2-68583).
 

Research Areas for SLC6A3/DAT1 Antibody (NBP2-68583)

Find related products by research area.

Blogs on SLC6A3/DAT1

There are no specific blogs for SLC6A3/DAT1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A3/DAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A3
Novus 100% Guarantee