Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-62704] - Analysis in human adrenal gland and pancreas tissues using Anti-SLC6A2 antibody. Corresponding ...read more
Immunohistochemistry-Paraffin: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-62704] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-62704] - Staining of human pancreas shows low expression as expected.
Novus Biologicals Rabbit SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free (NBP2-62704) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC6A2/NET/Noradrenaline transporter Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
NAT1
NAT1neurotransmitter transporter
NET
NET1sodium-dependent noradrenaline transporter
Noradrenalin Transporter
Norepinephrine Transporter
SLC6A2
SLC6A5
solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
Solute carrier family 6 member 2
solute carrier family 6 member 5
Background
Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for SLC6A2/NET/Noradrenaline transporter Antibody (NBP2-62704) (0)
There are no reviews for SLC6A2/NET/Noradrenaline transporter Antibody (NBP2-62704).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free and receive a gift card or discount.