GlyT1/SLC6A9 Antibody


Immunocytochemistry/ Immunofluorescence: GlyT1/SLC6A9 Antibody [NBP1-81820] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green
Immunohistochemistry-Paraffin: GlyT1/SLC6A9 Antibody [NBP1-81820] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GlyT1/SLC6A9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Specificity of human GlyT1/SLC6A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GlyT1/SLC6A9 Protein (NBP1-81820PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GlyT1/SLC6A9 Antibody

  • DKFZp547A1118
  • GlyT1
  • GlyT-1
  • GLYT1glyT-1
  • SLC6A9
  • sodium- and chloride-dependent glycine transporter 1
  • solute carrier family 6 (neurotransmitter transporter, glycine), member 9
  • Solute carrier family 6 member 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, TCS
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vivo
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for GlyT1/SLC6A9 Antibody (NBP1-81820) (0)

There are no publications for GlyT1/SLC6A9 Antibody (NBP1-81820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GlyT1/SLC6A9 Antibody (NBP1-81820) (0)

There are no reviews for GlyT1/SLC6A9 Antibody (NBP1-81820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GlyT1/SLC6A9 Antibody (NBP1-81820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GlyT1/SLC6A9 Antibody (NBP1-81820)

Discover related pathways, diseases and genes to GlyT1/SLC6A9 Antibody (NBP1-81820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GlyT1/SLC6A9 Antibody (NBP1-81820)

Discover more about diseases related to GlyT1/SLC6A9 Antibody (NBP1-81820).

Pathways for GlyT1/SLC6A9 Antibody (NBP1-81820)

View related products by pathway.

PTMs for GlyT1/SLC6A9 Antibody (NBP1-81820)

Learn more about PTMs related to GlyT1/SLC6A9 Antibody (NBP1-81820).

Blogs on GlyT1/SLC6A9

There are no specific blogs for GlyT1/SLC6A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GlyT1/SLC6A9 Antibody and receive a gift card or discount.


Gene Symbol SLC6A9