SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Adult Placenta

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Tissue:Human Fetal Lung.

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Fetal Heart.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC6A2(solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2) The peptide sequence was selected from the middle region of SLC6A2. Peptide sequence STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

• NAT1
• NAT1neurotransmitter transporter
• NET
• NET1sodium-dependent noradrenaline transporter
• Noradrenalin Transporter
• Norepinephrine Transporter
• SLC6A2
• SLC6A5
• solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
• Solute carrier family 6 member 2
• solute carrier family 6 member 5

Background

The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis (Kim et al., 2006 [PubMed 17146058]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A2
• Uniprot:
  • P23975(Human)