SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1) [NBP3-33387] - Western blot analysis of various lysates, using SLC6A2/NET/Noradrenaline transporter Rabbit mAb at 1:16000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6F7V1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2/NET/Noradrenaline transporter.1).
  
  Sequence:
  MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SLC6A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:2000 - 1:10000
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

• NAT1
• NAT1neurotransmitter transporter
• NET
• NET1sodium-dependent noradrenaline transporter
• Noradrenalin Transporter
• Norepinephrine Transporter
• SLC6A2
• SLC6A5
• solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
• Solute carrier family 6 member 2
• solute carrier family 6 member 5

Background

Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A2