SLC6A14 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining in human salivary gland and skeletal muscle tissues using NBP1-86521 antibody. Corresponding SLC6A14 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human breast shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human salivary gland shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC6A14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC6A14 Protein (NBP1-86521PEP)
Publications
Read Publications using
NBP1-86521 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26106611).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC6A14 Antibody

  • Amino acid transporter ATB0+
  • amino acid transporter B0+
  • BMIQ11
  • OBX
  • sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
  • solute carrier family 6 (amino acid transporter), member 14
  • solute carrier family 6 (neurotransmitter transporter), member 14
  • Solute carrier family 6 member 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-59857
Species: Hu
Applications: WB
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP2-75086
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-93638
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-93699
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47989
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-83553
Species: Hu
Applications: WB
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00009056-B01P
Species: Hu, Rt
Applications: WB
NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006583-A01
Species: Hu, Mu, Rt, Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP2-92417
Species: Hu, Mu
Applications: WB
NBP2-15958
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-87715
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC6A14 Antibody (NBP1-86521)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC6A14 Antibody (NBP1-86521) (0)

There are no reviews for SLC6A14 Antibody (NBP1-86521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC6A14 Antibody (NBP1-86521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC6A14 Products

Bioinformatics Tool for SLC6A14 Antibody (NBP1-86521)

Discover related pathways, diseases and genes to SLC6A14 Antibody (NBP1-86521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A14 Antibody (NBP1-86521)

Discover more about diseases related to SLC6A14 Antibody (NBP1-86521).
 

Pathways for SLC6A14 Antibody (NBP1-86521)

View related products by pathway.

PTMs for SLC6A14 Antibody (NBP1-86521)

Learn more about PTMs related to SLC6A14 Antibody (NBP1-86521).

Blogs on SLC6A14

There are no specific blogs for SLC6A14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A14
Entrez
Uniprot