SLC5A8/SMCT1 Antibody

Images

 
Western Blot: SLC5A8 Antibody [NBP1-62527] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC5A8/SMCT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC5A8(solute carrier family 5 (iodide transporter), member 8) The peptide sequence was selected from the middle region of SLC5A8. Peptide sequence GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC5A8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC5A8 and was validated on Western blot.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-62527 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC5A8/SMCT1 Antibody

  • AIT
  • AITSolute carrier family 5 member 8
  • Apical iodide transporter
  • Electrogenic sodium monocarboxylate cotransporter
  • MGC125354
  • SLC5A8
  • SMCT
  • SMCTSMCT1
  • Sodium iodide-related cotransporter
  • sodium-coupled monocarboxylate transporter 1
  • solute carrier family 5 (iodide transporter), member 8

Background

SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49322
Species: Hu
Applications: IHC
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
MAB4099
Species: Hu
Applications: WB, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87846
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP1-62527
Species: Hu
Applications: WB

Publications for SLC5A8/SMCT1 Antibody (NBP1-62527)(2)

Reviews for SLC5A8/SMCT1 Antibody (NBP1-62527) (0)

There are no reviews for SLC5A8/SMCT1 Antibody (NBP1-62527). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC5A8/SMCT1 Antibody (NBP1-62527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC5A8/SMCT1 Products

Bioinformatics Tool for SLC5A8/SMCT1 Antibody (NBP1-62527)

Discover related pathways, diseases and genes to SLC5A8/SMCT1 Antibody (NBP1-62527). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC5A8/SMCT1 Antibody (NBP1-62527)

Discover more about diseases related to SLC5A8/SMCT1 Antibody (NBP1-62527).
 

Pathways for SLC5A8/SMCT1 Antibody (NBP1-62527)

View related products by pathway.

PTMs for SLC5A8/SMCT1 Antibody (NBP1-62527)

Learn more about PTMs related to SLC5A8/SMCT1 Antibody (NBP1-62527).

Blogs on SLC5A8/SMCT1

There are no specific blogs for SLC5A8/SMCT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC5A8/SMCT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A8
Entrez
Uniprot