SLC4A8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC4A8 Antibody [NBP3-17312] - Staining of human cell line AF22 shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC4A8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRV
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC4A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC4A8 Antibody - BSA Free

• DKFZp761B2318
• Electroneutral Na(+)-driven Cl-HCO3 exchanger
• FLJ46462
• KIAA0739
• k-NBC3
• Na+-driven Cl-HCO3 exchanger
• NBC
• NBC3electroneutral sodium bicarbonate exchanger 1
• NDCBE
• NDCBE1
• Solute carrier family 4 member 8
• solute carrier family 4, sodium bicarbonate cotransporter, member 8

Background

SLC4A8 mediates electroneutral sodium- and carbonate-dependent choride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3(-) from blood to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC4A8