SLC4A10 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and neuropil.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC4A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC4A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC4A10 Protein (NBP1-82594PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC4A10 Antibody

  • sodium bicarbonate cotransporter-like, member 10
  • sodium bicarbonate transporter-like, member 10
  • sodium-driven chloride bicarbonate exchanger
  • Solute carrier family 4 member 10
  • solute carrier family 4, sodium bicarbonate transporter, member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009498-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-59528
Species: Hu
Applications: WB
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13340
Species: Hu
Applications: IHC, IHC-P
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-88514
Species: Hu
Applications: IHC, IHC-P
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-54703
Species: Hu
Applications: IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC

Publications for SLC4A10 Antibody (NBP1-82594) (0)

There are no publications for SLC4A10 Antibody (NBP1-82594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A10 Antibody (NBP1-82594) (0)

There are no reviews for SLC4A10 Antibody (NBP1-82594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC4A10 Antibody (NBP1-82594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC4A10 Products

Bioinformatics Tool for SLC4A10 Antibody (NBP1-82594)

Discover related pathways, diseases and genes to SLC4A10 Antibody (NBP1-82594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC4A10 Antibody (NBP1-82594)

Discover more about diseases related to SLC4A10 Antibody (NBP1-82594).
 

Pathways for SLC4A10 Antibody (NBP1-82594)

View related products by pathway.

PTMs for SLC4A10 Antibody (NBP1-82594)

Learn more about PTMs related to SLC4A10 Antibody (NBP1-82594).

Blogs on SLC4A10

There are no specific blogs for SLC4A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC4A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A10