SLC4A10 Antibody


Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and neuropil.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC4A10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT
Specificity of human SLC4A10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC4A10 Protein (NBP1-82594PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC4A10 Antibody

  • sodium bicarbonate cotransporter-like, member 10
  • sodium bicarbonate transporter-like, member 10
  • sodium-driven chloride bicarbonate exchanger
  • Solute carrier family 4 member 10
  • solute carrier family 4, sodium bicarbonate transporter, member 10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for SLC4A10 Antibody (NBP1-82594) (0)

There are no publications for SLC4A10 Antibody (NBP1-82594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A10 Antibody (NBP1-82594) (0)

There are no reviews for SLC4A10 Antibody (NBP1-82594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC4A10 Antibody (NBP1-82594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC4A10 Antibody (NBP1-82594)

Discover related pathways, diseases and genes to SLC4A10 Antibody (NBP1-82594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC4A10 Antibody (NBP1-82594)

Discover more about diseases related to SLC4A10 Antibody (NBP1-82594).

Pathways for SLC4A10 Antibody (NBP1-82594)

View related products by pathway.

PTMs for SLC4A10 Antibody (NBP1-82594)

Learn more about PTMs related to SLC4A10 Antibody (NBP1-82594).

Blogs on SLC4A10

There are no specific blogs for SLC4A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC4A10 Antibody and receive a gift card or discount.


Gene Symbol SLC4A10