![Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Analysis in human cerebral cortex and lymph node tissues using NBP1-82594 antibody. Corresponding SLC4A10 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC4A10-Antibody-Immunohistochemistry-Paraffin-NBP1-82594-img0002.jpg "Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Analysis in human cerebral cortex and lymph node tissues using NBP1-82594 antibody. Corresponding SLC4A10 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SLC4A10 Antibody - BSA Free (NBP1-82594) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC4A10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC4A10 Antibody (NBP1-82594)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC4A10 |
![Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SLC4A10-Antibody-Immunohistochemistry-Paraffin-NBP1-82594-img0005.jpg "Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.](http://images.novusbio.com/fullsize/SLC4A10-Antibody-Immunohistochemistry-Paraffin-NBP1-82594-img0003.jpg "Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.")
![Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.](http://images.novusbio.com/fullsize/SLC4A10-Antibody-Immunohistochemistry-Paraffin-NBP1-82594-img0004.jpg "Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC4A10-Antibody-Immunohistochemistry-Paraffin-NBP1-82594-img0006.jpg "Immunohistochemistry-Paraffin: SLC4A10 Antibody [NBP1-82594] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.")
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")