SLC4A4 Antibody


Immunohistochemistry: SLC4A4 Antibody [NBP2-32021] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC4A4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC4A4 Protein (NBP2-32021PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC4A4 Antibody

  • electrogenic sodium bicarbonate cotransporter 1
  • hhNMC
  • HNBC1
  • KNBC
  • kNBC1
  • Na(+)/HCO3(-) cotransporter
  • NBC
  • NBC1DKFZp781H1314
  • NBC2
  • NBCE1
  • pNBC
  • SLC4A5
  • sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas)
  • Sodium bicarbonate cotransporter
  • Solute carrier family 4 member 4
  • solute carrier family 4, sodium bicarbonate cotransporter, member 4
  • solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
  • solute carrier family 4, sodium bicarbonate cotransporter, member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SLC4A4 Antibody (NBP2-32021) (0)

There are no publications for SLC4A4 Antibody (NBP2-32021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A4 Antibody (NBP2-32021) (0)

There are no reviews for SLC4A4 Antibody (NBP2-32021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC4A4 Antibody (NBP2-32021). (Showing 1 - 1 of 1 FAQ).

  1. Have any of your SLC4A4 antibodies been tested for use in IHC?
    • The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our <a href="" target="_self">Innovators Reward Program</a>. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Secondary Antibodies


Isotype Controls

Additional SLC4A4 Products

Bioinformatics Tool for SLC4A4 Antibody (NBP2-32021)

Discover related pathways, diseases and genes to SLC4A4 Antibody (NBP2-32021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC4A4 Antibody (NBP2-32021)

Discover more about diseases related to SLC4A4 Antibody (NBP2-32021).

Pathways for SLC4A4 Antibody (NBP2-32021)

View related products by pathway.

PTMs for SLC4A4 Antibody (NBP2-32021)

Learn more about PTMs related to SLC4A4 Antibody (NBP2-32021).

Blogs on SLC4A4

There are no specific blogs for SLC4A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC4A4 Antibody and receive a gift card or discount.


Gene Symbol SLC4A4