SLC39A8/ZIP8 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human salivary gland shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows distinct membranous positivity in syncytiotrophoblasts.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human pancreas shows negative membranous positivity in islets of Langerhans and moderate membranous positivity in exocrien pancreas.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human lung shows moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human rectum shows moderate membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC39A8/ZIP8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC39A8/ZIP8 Antibody - BSA Free (NBP2-34058) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC39A8/ZIP8 Protein (NBP2-34058PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC39A8/ZIP8 Antibody - BSA Free

• BCG induced integral membrane protein BIGM103
• BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein
• LIV-1 subfamily of ZIP zinc transporter 6
• LZT-Hs6
• solute carrier family 39 (metal ion transporter), member 8
• solute carrier family 39 (zinc transporter), member 8
• Solute carrier family 39 member 8
• zinc transporter ZIP8
• ZIP8
• ZIP-8
• Zrt- and Irt-like protein 8

Background

The SLC39A8 gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A8
• Uniprot:
  • Q9C0K1(Human)