SLC39A8/ZIP8 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP1-88605] - Staining of human salivary gland shows moderate luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC39A8/ZIP8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC39A8/ZIP8 Protein (NBP1-88605PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC39A8/ZIP8 Antibody

  • BCG induced integral membrane protein BIGM103
  • BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein
  • LIV-1 subfamily of ZIP zinc transporter 6
  • LZT-Hs6
  • solute carrier family 39 (metal ion transporter), member 8
  • solute carrier family 39 (zinc transporter), member 8
  • Solute carrier family 39 member 8
  • zinc transporter ZIP8
  • ZIP8
  • ZIP-8
  • Zrt- and Irt-like protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-76507
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready

Publications for SLC39A8/ZIP8 Antibody (NBP1-88605) (0)

There are no publications for SLC39A8/ZIP8 Antibody (NBP1-88605).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A8/ZIP8 Antibody (NBP1-88605) (0)

There are no reviews for SLC39A8/ZIP8 Antibody (NBP1-88605). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC39A8/ZIP8 Antibody (NBP1-88605) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC39A8/ZIP8 Products

Bioinformatics Tool for SLC39A8/ZIP8 Antibody (NBP1-88605)

Discover related pathways, diseases and genes to SLC39A8/ZIP8 Antibody (NBP1-88605). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A8/ZIP8 Antibody (NBP1-88605)

Discover more about diseases related to SLC39A8/ZIP8 Antibody (NBP1-88605).
 

Pathways for SLC39A8/ZIP8 Antibody (NBP1-88605)

View related products by pathway.

PTMs for SLC39A8/ZIP8 Antibody (NBP1-88605)

Learn more about PTMs related to SLC39A8/ZIP8 Antibody (NBP1-88605).

Blogs on SLC39A8/ZIP8

There are no specific blogs for SLC39A8/ZIP8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC39A8/ZIP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A8