SLC38A2 Antibody

Images

 
Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC38A2. Peptide sequence: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Porcine (100%), Rabbit (93%), Bovine (93%), Guinea Pig (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A2 Antibody

  • Amino acid transporter A2
  • ata2
  • ATA2System A transporter 1
  • KIAA1382System N amino acid transporter 2
  • pro1068
  • Protein 40-9-1
  • sat2
  • SAT2PRO1068
  • snat2
  • SNAT2amino acid transporter 2
  • sodium-coupled neutral amino acid transporter 2
  • Solute carrier family 38 member 2
  • solute carrier family 38, member 2
  • System A amino acid transporter 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-55228
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89327
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47989
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
AF4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC38A2 Antibody (NBP2-83554) (0)

There are no publications for SLC38A2 Antibody (NBP2-83554).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A2 Antibody (NBP2-83554) (0)

There are no reviews for SLC38A2 Antibody (NBP2-83554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC38A2 Antibody (NBP2-83554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC38A2 Products

Bioinformatics Tool for SLC38A2 Antibody (NBP2-83554)

Discover related pathways, diseases and genes to SLC38A2 Antibody (NBP2-83554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A2 Antibody (NBP2-83554)

Discover more about diseases related to SLC38A2 Antibody (NBP2-83554).
 

Pathways for SLC38A2 Antibody (NBP2-83554)

View related products by pathway.

PTMs for SLC38A2 Antibody (NBP2-83554)

Learn more about PTMs related to SLC38A2 Antibody (NBP2-83554).

Blogs on SLC38A2

There are no specific blogs for SLC38A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A2