SLC26A6 Antibody

Images

 
Immunohistochemistry: SLC26A6 Antibody [NBP2-47273] - Staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS
Specificity
Specificity of human SLC26A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC26A6 Protein (NBP2-47273PEP)
Publications
Read Publication using
NBP2-47273 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC26A6 Antibody

  • anion transporter 1
  • DKFZp586E1422
  • pendrin L1
  • pendrin-L1
  • Pendrin-like protein 1
  • solute carrier family 26 member 6
  • solute carrier family 26, member 6
  • sulfate anion transporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50113
Species: Hu
Applications: WB, ICC/IF, IHC, IP
NBP2-13340
Species: Hu
Applications: IHC, IHC-P
NBP2-13336
Species: Hu
Applications: IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP2-47273
Species: Hu
Applications: IHC, IHC-P

Publications for SLC26A6 Antibody (NBP2-47273)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC26A6 Antibody (NBP2-47273) (0)

There are no reviews for SLC26A6 Antibody (NBP2-47273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC26A6 Antibody (NBP2-47273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC26A6 Antibody (NBP2-47273)

Discover related pathways, diseases and genes to SLC26A6 Antibody (NBP2-47273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A6 Antibody (NBP2-47273)

Discover more about diseases related to SLC26A6 Antibody (NBP2-47273).
 

Pathways for SLC26A6 Antibody (NBP2-47273)

View related products by pathway.

PTMs for SLC26A6 Antibody (NBP2-47273)

Learn more about PTMs related to SLC26A6 Antibody (NBP2-47273).

Blogs on SLC26A6

There are no specific blogs for SLC26A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A6