SLC26A6 Antibody - BSA Free

Western Blot: SLC26A6 Antibody [NBP2-47273] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SLC26A6 Antibody [NBP2-47273] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC26A6 Antibody [NBP2-47273] - Staining of human rectum shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC26A6 Antibody [NBP2-47273] - Staining of human cerebellum shows moderate membranous positivity in Purkinje cells.

Immunohistochemistry-Paraffin: SLC26A6 Antibody [NBP2-47273] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC26A6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC26A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC26A6 Protein (NBP2-47273PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC26A6 Antibody - BSA Free

• anion transporter 1
• DKFZp586E1422
• pendrin L1
• pendrin-L1
• Pendrin-like protein 1
• solute carrier family 26 member 6
• solute carrier family 26, member 6
• sulfate anion transporter

Background

SLC26A6 belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Several alternatively spliced transcript variants of this gene, encoding distinct isoforms, have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC26A6 Antibody (NBP2-47273)(1)

Publication using NBP2-47273

• Ilves T, Virolainen A, Harvima IT. Immediate Wheal Reactivity to Autologous Sweat in Atopic Dermatitis Is Associated with Clinical Severity, Serum Total and Specific IgE and Sweat Tryptase Activity Int. Arch. Allergy Immunol. 2016-07-22 [PMID: 27442010] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SLC26A6