SLC22A13 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC22A13 Antibody [NBP1-82502] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC22A13 Antibody [NBP1-82502] - Staining of human kidney shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC22A13 Antibody [NBP1-82502] - Staining in human kidney and lymph node tissues using anti-SLC22A13 antibody. Corresponding SLC22A13 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC22A13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY
Specificity
Specificity of human SLC22A13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC22A13 Protein (NBP1-82502PEP)
Publications
Read Publication using NBP1-82502.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A13 Antibody

  • OAT10
  • OCTL1
  • OCTL3
  • ORCTL3
  • ORCTL-3
  • Organic cation transporter-like 3
  • organic cationic transporter-like 3
  • organic-cation transporter like 3
  • solute carrier family 22 (organic anion transporter), member 13
  • solute carrier family 22 member 13
  • solute carrier family 22, member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59398
Species: Hu
Applications: WB
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-69536
Species: Hu
Applications: WB
H00116085-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-80524
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87909
Species: Hu, Rt
Applications: IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC22A13 Antibody (NBP1-82502)(1)

Reviews for SLC22A13 Antibody (NBP1-82502) (0)

There are no reviews for SLC22A13 Antibody (NBP1-82502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC22A13 Antibody (NBP1-82502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC22A13 Products

Bioinformatics Tool for SLC22A13 Antibody (NBP1-82502)

Discover related pathways, diseases and genes to SLC22A13 Antibody (NBP1-82502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A13 Antibody (NBP1-82502)

Discover more about diseases related to SLC22A13 Antibody (NBP1-82502).
 

Pathways for SLC22A13 Antibody (NBP1-82502)

View related products by pathway.

Blogs on SLC22A13

There are no specific blogs for SLC22A13, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A13