SLC22A8 Antibody (3C11) - Azide and BSA Free

Western Blot: SLC22A8 Antibody (3C11) [H00009376-M02] - SLC22A8 monoclonal antibody (M02), clone 3C11. Analysis of SLC22A8 expression in rat muscle.

ELISA: SLC22A8 Antibody (3C11) [H00009376-M02] - Detection limit for recombinant GST tagged SLC22A8 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 3C11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC22A8 Antibody (3C11) - Azide and BSA Free Summary

• Immunogen: SLC22A8 (NP_004245.2, 256 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR
• Specificity: SLC22A8 - solute carrier family 22 (organic anion transporter), member 8 (3C11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC22A8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC22A8 Antibody (3C11) - Azide and BSA Free

• hOAT3
• MGC24086
• OAT3Organic anion transporter 3
• solute carrier family 22 (organic anion transporter), member 8
• solute carrier family 22 member 8

Background

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A8
• Entrez:
  • 9376(Human)
• Uniprot:
  • NP_004245(Human)