SLC22A6 Antibody


Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human kidney shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Analysis in human kidney and lymph node tissues using Anti-SLC22A6 antibody. Corresponding SLC22A6 RNA-seq data are presented more
Immunohistochemistry-Paraffin: SLC22A6 Antibody [NBP2-62690] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SLC22A6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC22A6 Recombinant Protein Antigen (NBP2-62690PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for SLC22A6 Antibody

  • hOAT1
  • hPAHT
  • hROAT1
  • MGC45260
  • OAT1FLJ55736
  • Organic anion transporter 1
  • PAH transporter
  • para-aminohippurate transporter
  • Renal organic anion transporter 1
  • ROAT1
  • solute carrier family 22 (organic anion transporter), member 6
  • solute carrier family 22 member 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P

Publications for SLC22A6 Antibody (NBP2-62690) (0)

There are no publications for SLC22A6 Antibody (NBP2-62690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A6 Antibody (NBP2-62690) (0)

There are no reviews for SLC22A6 Antibody (NBP2-62690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC22A6 Antibody (NBP2-62690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC22A6 Antibody (NBP2-62690)

Discover related pathways, diseases and genes to SLC22A6 Antibody (NBP2-62690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A6 Antibody (NBP2-62690)

Discover more about diseases related to SLC22A6 Antibody (NBP2-62690).

Pathways for SLC22A6 Antibody (NBP2-62690)

View related products by pathway.

PTMs for SLC22A6 Antibody (NBP2-62690)

Learn more about PTMs related to SLC22A6 Antibody (NBP2-62690).

Blogs on SLC22A6

There are no specific blogs for SLC22A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC22A6 Antibody and receive a gift card or discount.


Gene Symbol SLC22A6