SLC22A2/OCT2 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human liver shows no positivity in hepatocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Analysis in human kidney and liver tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human kidney shows moderate to strong cytoplasmic/membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P, Single-Cell Western
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC22A2/OCT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Specificity
Specificity of human SLC22A2/OCT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Single Cell Western 100 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID: 26045896).
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
SLC22A2/OCT2 Protein (NBP1-89417PEP)
Publications
Read Publications using
NBP1-89417 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse (84%). Rat reactivity reported in scientific literature (PMID:24887156).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A2/OCT2 Antibody

  • hOCT2
  • MGC32628
  • OCT2
  • OCT2Organic cation transporter 2
  • SLC22A2
  • solute carrier family 22 (organic cation transporter), member 2
  • solute carrier family 22 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87909
Species: Hu, Rt
Applications: IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-93859
Species: Hu, Mu, Rt
Applications: WB, IHC
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP2-75752
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
H00006583-A01
Species: Hu, Mu, Rt, Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western

Publications for SLC22A2/OCT2 Antibody (NBP1-89417)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for SLC22A2/OCT2 Antibody (NBP1-89417) (0)

There are no reviews for SLC22A2/OCT2 Antibody (NBP1-89417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A2/OCT2 Antibody (NBP1-89417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC22A2/OCT2 Products

Bioinformatics Tool for SLC22A2/OCT2 Antibody (NBP1-89417)

Discover related pathways, diseases and genes to SLC22A2/OCT2 Antibody (NBP1-89417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A2/OCT2 Antibody (NBP1-89417)

Discover more about diseases related to SLC22A2/OCT2 Antibody (NBP1-89417).
 

Pathways for SLC22A2/OCT2 Antibody (NBP1-89417)

View related products by pathway.

PTMs for SLC22A2/OCT2 Antibody (NBP1-89417)

Learn more about PTMs related to SLC22A2/OCT2 Antibody (NBP1-89417).

Blogs on SLC22A2/OCT2

There are no specific blogs for SLC22A2/OCT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A2/OCT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A2
Entrez
Uniprot