SLC22A2/OCT2 Antibody

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Analysis in human kidney and liver tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human kidney shows moderate to strong cytoplasmic/membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu, Rt
• Applications: WB, IHC, IHC-P, Single-Cell Western
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC22A2/OCT2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Single Cell Western 100 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID: 26045896). Single Cell Western reported by an internal validation at a 1:20 dilution
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SLC22A2/OCT2 Protein (NBP1-89417PEP)

Reactivity Notes

Mouse (84%). Rat reactivity reported in scientific literature (PMID:24887156).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC22A2/OCT2 Antibody

• hOCT2
• MGC32628
• OCT2
• OCT2Organic cation transporter 2
• SLC22A2
• solute carrier family 22 (organic cation transporter), member 2
• solute carrier family 22 member 2

Background

SLC22A2 - solute carrier family 22 (organic cation transporter), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC22A2/OCT2 Antibody (NBP1-89417)(2)

Publications using NBP1-89417

• Li X, Cui P, Jiang HY et al. Reversing the reduced level of endometrial GLUT4 expression in polycystic ovary syndrome: a mechanistic study of metformin action. Am J Transl Res 2015-01-01 [PMID: 26045896] (WB, Human)
• Shao R, Li X, Feng Y, Lin JF, Billig H. Direct effects of metformin in the endometrium: a hypothetical mechanism for the treatment of women with PCOS and endometrial carcinoma. J Exp Clin Cancer Res 2014-05-11 [PMID: 24887156] (IF/IHC, Rat)

Bioinformatics

• Gene Symbol: SLC22A2
• Entrez:
  • 6582(Human)
• Uniprot:
  • O15244()