Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC22A2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID: 26045896). Single Cell Western reported by an internal validation at a 1:20 dilution |
||
Theoretical MW | 63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC22A2/OCT2 Antibody (NBP1-89417)Discover more about diseases related to SLC22A2/OCT2 Antibody (NBP1-89417).
| Pathways for SLC22A2/OCT2 Antibody (NBP1-89417)View related products by pathway.
|
PTMs for SLC22A2/OCT2 Antibody (NBP1-89417)Learn more about PTMs related to SLC22A2/OCT2 Antibody (NBP1-89417).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.