SLC22A2/OCT2 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human skin shows strong cytoplasmic positivity in basal layer of epidermal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A2/OCT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in scientific literature (PMID: 26045896)
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
SLC22A2/OCT2 Protein (NBP1-89417PEP)
Publications
Read Publications using
NBP1-89417 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse (84%). Rat reactivity reported in scientific literature (PMID:24887156).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A2/OCT2 Antibody

  • hOCT2
  • MGC32628
  • OCT2
  • OCT2Organic cation transporter 2
  • SLC22A2
  • solute carrier family 22 (organic cation transporter), member 2
  • solute carrier family 22 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87909
Species: Hu
Applications: IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC22A2/OCT2 Antibody (NBP1-89417)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for SLC22A2/OCT2 Antibody (NBP1-89417) (0)

There are no reviews for SLC22A2/OCT2 Antibody (NBP1-89417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A2/OCT2 Antibody (NBP1-89417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A2/OCT2 Products

Bioinformatics Tool for SLC22A2/OCT2 Antibody (NBP1-89417)

Discover related pathways, diseases and genes to SLC22A2/OCT2 Antibody (NBP1-89417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A2/OCT2 Antibody (NBP1-89417)

Discover more about diseases related to SLC22A2/OCT2 Antibody (NBP1-89417).
 

Pathways for SLC22A2/OCT2 Antibody (NBP1-89417)

View related products by pathway.

PTMs for SLC22A2/OCT2 Antibody (NBP1-89417)

Learn more about PTMs related to SLC22A2/OCT2 Antibody (NBP1-89417).

Blogs on SLC22A2/OCT2

There are no specific blogs for SLC22A2/OCT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A2/OCT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A2
Entrez
Uniprot