SLC22A2/OCT2 Antibody - BSA Free

Western Blot: SLC22A2 Antibody [NBP1-59451] - HepG2 cell lysate, concentration 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SLC22A2/OCT2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC22A2(solute carrier family 22 (organic cation transporter), member 2) The peptide sequence was selected from the N terminal of SLC22A2. Peptide sequence MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SLC22A2/OCT2 Antibody - BSA Free

• hOCT2
• MGC32628
• OCT2
• OCT2Organic cation transporter 2
• SLC22A2
• solute carrier family 22 (organic cation transporter), member 2
• solute carrier family 22 member 2

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC22A2/OCT2 Antibody (NBP1-59451)(1)

Publication using NBP1-59451

• Tirsa T. van Duijl, L. Renee Ruhaak, Nico P. M. Smit, Mervin M. Pieterse, Fred P. H. T. M. Romijn, Natasja Dolezal, Jan Wouter Drijfhout, Johan W. de Fijter, Christa M. Cobbaert Development and Provisional Validation of a Multiplex LC-MRM-MS Test for Timely Kidney Injury Detection in Urine Journal of Proteome Research 2021-11-04 [PMID: 34735145]

Bioinformatics

• Gene Symbol: SLC22A2
• Uniprot:
  • O15244()