SLC22A15 Antibody

Images

 
Western Blot: SLC22A15 Antibody [NBP1-62420] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A15 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC22A15 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A15 Antibody

  • DKFZp761G0313
  • Flipt 1
  • FLIPT1PRO34686
  • fly-like putative organic ion transporter 1
  • Fly-like putative transporter 1
  • solute carrier family 22 (organic cation transporter), member 15
  • solute carrier family 22 member 15
  • solute carrier family 22, member 15
  • trans-like protein

Background

Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphil

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-05754
Species: Hu
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-04309
Species: Hu
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-91568
Species: Hu
Applications: WB
NBP1-62420
Species: Hu
Applications: WB

Publications for SLC22A15 Antibody (NBP1-62420) (0)

There are no publications for SLC22A15 Antibody (NBP1-62420).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A15 Antibody (NBP1-62420) (0)

There are no reviews for SLC22A15 Antibody (NBP1-62420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A15 Antibody (NBP1-62420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A15 Products

Bioinformatics Tool for SLC22A15 Antibody (NBP1-62420)

Discover related pathways, diseases and genes to SLC22A15 Antibody (NBP1-62420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A15 Antibody (NBP1-62420)

Discover more about diseases related to SLC22A15 Antibody (NBP1-62420).
 

Pathways for SLC22A15 Antibody (NBP1-62420)

View related products by pathway.

Blogs on SLC22A15

There are no specific blogs for SLC22A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A15