Recombinant Human SLC22A12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC22A12 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 281 - 349 of Human SLC22A12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC22A12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC22A12 Protein

  • OATL4
  • Organic anion transporter 4-like protein
  • Renal-specific transporter
  • RSTmember 12
  • solute carrier family 22 (organic anion/urate transporter), member 12
  • URAT1
  • URAT1Urate anion exchanger 1
  • urate transporter 1

Background

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB3307
Species: Hu
Applications: WB, IP
NBP1-69536
Species: Hu
Applications: WB
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-05754
Species: Hu
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
MAB8398
Species: Hu
Applications: Flow, CyTOF-ready
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57222
Species: Hu
Applications: ICC/IF
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SLC22A12 Partial Recombinant Protein (H00116085-Q02) (0)

There are no publications for SLC22A12 Partial Recombinant Protein (H00116085-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A12 Partial Recombinant Protein (H00116085-Q02) (0)

There are no reviews for SLC22A12 Partial Recombinant Protein (H00116085-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A12 Partial Recombinant Protein (H00116085-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC22A12 Products

Bioinformatics Tool for SLC22A12 Partial Recombinant Protein (H00116085-Q02)

Discover related pathways, diseases and genes to SLC22A12 Partial Recombinant Protein (H00116085-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A12 Partial Recombinant Protein (H00116085-Q02)

Discover more about diseases related to SLC22A12 Partial Recombinant Protein (H00116085-Q02).
 

Pathways for SLC22A12 Partial Recombinant Protein (H00116085-Q02)

View related products by pathway.

PTMs for SLC22A12 Partial Recombinant Protein (H00116085-Q02)

Learn more about PTMs related to SLC22A12 Partial Recombinant Protein (H00116085-Q02).

Blogs on SLC22A12

There are no specific blogs for SLC22A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC22A12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A12