SLC22A12 Antibody


Western Blot: SLC22A12 Antibody [NBP1-69538] - WB Suggested Anti-SLC22A12 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: DU145 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC22A12 Antibody Summary

Synthetic peptides corresponding to SLC22A12(solute carrier family 22 (organic anion/urate transporter), member 12) The peptide sequence was selected from the N terminal of SLC22A12. Peptide sequence SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC22A12 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A12 Antibody

  • OATL4
  • Organic anion transporter 4-like protein
  • Renal-specific transporter
  • RSTmember 12
  • solute carrier family 22 (organic anion/urate transporter), member 12
  • URAT1
  • URAT1Urate anion exchanger 1
  • urate transporter 1


SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Ba
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SLC22A12 Antibody (NBP1-69538) (0)

There are no publications for SLC22A12 Antibody (NBP1-69538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A12 Antibody (NBP1-69538) (0)

There are no reviews for SLC22A12 Antibody (NBP1-69538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A12 Antibody (NBP1-69538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC22A12 Antibody (NBP1-69538)

Discover related pathways, diseases and genes to SLC22A12 Antibody (NBP1-69538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A12 Antibody (NBP1-69538)

Discover more about diseases related to SLC22A12 Antibody (NBP1-69538).

Pathways for SLC22A12 Antibody (NBP1-69538)

View related products by pathway.

PTMs for SLC22A12 Antibody (NBP1-69538)

Learn more about PTMs related to SLC22A12 Antibody (NBP1-69538).

Blogs on SLC22A12

There are no specific blogs for SLC22A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC22A12 Antibody and receive a gift card or discount.


Gene Symbol SLC22A12