SLC16A6 Antibody - BSA Free

Western Blot: SLC16A6 Antibody [NBP1-59881] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC16A6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC16A6(solute carrier family 16, member 6 (monocarboxylic acid transporter 7)) The peptide sequence was selected from the middle region of SLC16A6. Peptide sequence ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC16A6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC16A6 Antibody - BSA Free

• MCT 6
• MCT 7
• MCT6MCT 6
• MCT7
• MCT7MCT 7
• Monocarboxylate transporter 6
• monocarboxylate transporter 7
• SLC16A6
• solute carrier family 16 (monocarboxylic acid transporters), member 6
• Solute carrier family 16 member 6
• solute carrier family 16, member 6 (monocarboxylic acid transporter 7)

Background

SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC16A6
• Entrez:
  • 9120(Human)
• Uniprot:
  • O15403(Human)