SLC13A5 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC13A5 Antibody [NBP1-92394] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Staining of human liver shows moderate membranous positivity in hepatocytes.

Analysis in control (vector only transfected HEK293T lysate) and SLC13A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC13A5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC13A5 Antibody - BSA Free (NBP1-92394) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC13A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC13A5 Protein (NBP1-92394PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC13A5 Antibody - BSA Free

• DKFZp686E17257
• Na(+)/citrate cotransporter
• NaCT
• NACTMGC138356
• SLC13A5
• Sodium-coupled citrate transporter
• Sodium-dependent citrate transporter
• solute carrier family 13 (sodium-dependent citrate transporter), member 5
• solute carrier family 13 member 5
• solute carrier family 13, member 5

Background

SLC13A5 - solute carrier family 13 (sodium-dependent citrate transporter), member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A5