SLC13A5 Antibody

Images

 
Western Blot: SLC13A5 Antibody [NBP1-92394] - Analysis in control (vector only transfected HEK293T lysate) and SLC13A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: SLC13A5 Antibody [NBP1-92394] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: SLC13A5 Antibody [NBP1-92394] - Staining of human liver shows moderate membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC13A5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC13A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC13A5 Protein (NBP1-92394PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC13A5 Antibody

  • DKFZp686E17257
  • Na(+)/citrate cotransporter
  • NaCT
  • NACTMGC138356
  • Sodium-coupled citrate transporter
  • Sodium-dependent citrate transporter
  • solute carrier family 13 (sodium-dependent citrate transporter), member 5
  • solute carrier family 13 member 5
  • solute carrier family 13, member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82604
Species: Hu
Applications: IHC, IHC-P
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-60011
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01761
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93413
Species: Hu, Mu
Applications: WB
NBP1-31411
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-67667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-30984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for SLC13A5 Antibody (NBP1-92394) (0)

There are no publications for SLC13A5 Antibody (NBP1-92394).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC13A5 Antibody (NBP1-92394) (0)

There are no reviews for SLC13A5 Antibody (NBP1-92394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC13A5 Antibody (NBP1-92394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC13A5 Products

Bioinformatics Tool for SLC13A5 Antibody (NBP1-92394)

Discover related pathways, diseases and genes to SLC13A5 Antibody (NBP1-92394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC13A5 Antibody (NBP1-92394)

Discover more about diseases related to SLC13A5 Antibody (NBP1-92394).
 

Pathways for SLC13A5 Antibody (NBP1-92394)

View related products by pathway.

PTMs for SLC13A5 Antibody (NBP1-92394)

Learn more about PTMs related to SLC13A5 Antibody (NBP1-92394).

Blogs on SLC13A5

There are no specific blogs for SLC13A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC13A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC13A5