SLC13A1 Antibody

Images

 
Immunohistochemistry: SLC13A1 Antibody [NBP2-38970] - Staining of human kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC13A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNN
Specificity
Specificity of human SLC13A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC13A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC13A1 Protein (NBP2-38970PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC13A1 Antibody

  • solute carrier family 13 member 1
  • NAS1
  • NASI1
  • NaSi-1
  • SLC13A1
  • solute carrier family 13 (sodium/sulfate symporters), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-82604
Species: Hu
Applications: IHC, IHC-P
NBP2-13313
Species: Hu
Applications: IHC, IHC-P
NBP1-82603
Species: Hu
Applications: IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13336
Species: Hu
Applications: IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
H00284111-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-47273
Species: Hu
Applications: IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-86346
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-214
Species: Hu, Mu
Applications: WB, IP
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-38970
Species: Hu
Applications: IHC, IHC-P

Publications for SLC13A1 Antibody (NBP2-38970) (0)

There are no publications for SLC13A1 Antibody (NBP2-38970).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC13A1 Antibody (NBP2-38970) (0)

There are no reviews for SLC13A1 Antibody (NBP2-38970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC13A1 Antibody (NBP2-38970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC13A1 Antibody (NBP2-38970)

Discover related pathways, diseases and genes to SLC13A1 Antibody (NBP2-38970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC13A1 Antibody (NBP2-38970)

Discover more about diseases related to SLC13A1 Antibody (NBP2-38970).
 

Pathways for SLC13A1 Antibody (NBP2-38970)

View related products by pathway.

PTMs for SLC13A1 Antibody (NBP2-38970)

Learn more about PTMs related to SLC13A1 Antibody (NBP2-38970).

Blogs on SLC13A1

There are no specific blogs for SLC13A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC13A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC13A1
Uniprot