SLC26A11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC26A11 Antibody [NBP1-86346] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.

Immunohistochemistry-Paraffin: SLC26A11 Antibody [NBP1-86346] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and SLC26A11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC26A11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC26A11 Antibody - BSA Free (NBP1-86346) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC26A11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC26A11 Protein (NBP1-86346PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC26A11 Antibody - BSA Free

• MGC46523
• sodium-independent sulfate anion transporter
• Solute carrier family 26 member 11
• solute carrier family 26, member 11

Background

The SLC26A11 gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family ofproteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance.The encoded protein is a sod

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC26A11