SLC13A3/NaDC3 Antibody


Immunohistochemistry-Paraffin: SLC13A3/NaDC3 Antibody [NBP1-82603] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC13A3/NaDC3 Antibody [NBP1-82603] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubule cells.
Immunohistochemistry-Paraffin: SLC13A3/NaDC3 Antibody [NBP1-82603] - Staining in human kidney and lymph node tissues using anti-SLC13A3 antibody. Corresponding SLC13A3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC13A3/NaDC3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL
Specificity of human SLC13A3/NaDC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC13A3/NaDC3 Protein (NBP1-82603PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC13A3/NaDC3 Antibody

  • hNaDC3
  • Na(+)/dicarboxylate cotransporter 3
  • NaDC3
  • NaDC-3
  • NADC3SDCT2naDC-3
  • SDCT2
  • SLC13A3
  • sodium-dependent high affinity dicarboxylate transporter 3
  • Sodium-dependent high-affinity dicarboxylate transporter 2
  • solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
  • solute carrier family 13 member 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow

Publications for SLC13A3/NaDC3 Antibody (NBP1-82603) (0)

There are no publications for SLC13A3/NaDC3 Antibody (NBP1-82603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC13A3/NaDC3 Antibody (NBP1-82603) (0)

There are no reviews for SLC13A3/NaDC3 Antibody (NBP1-82603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC13A3/NaDC3 Antibody (NBP1-82603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC13A3/NaDC3 Products

Bioinformatics Tool for SLC13A3/NaDC3 Antibody (NBP1-82603)

Discover related pathways, diseases and genes to SLC13A3/NaDC3 Antibody (NBP1-82603). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC13A3/NaDC3 Antibody (NBP1-82603)

Discover more about diseases related to SLC13A3/NaDC3 Antibody (NBP1-82603).

Pathways for SLC13A3/NaDC3 Antibody (NBP1-82603)

View related products by pathway.

PTMs for SLC13A3/NaDC3 Antibody (NBP1-82603)

Learn more about PTMs related to SLC13A3/NaDC3 Antibody (NBP1-82603).

Blogs on SLC13A3/NaDC3

There are no specific blogs for SLC13A3/NaDC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC13A3/NaDC3 Antibody and receive a gift card or discount.


Gene Symbol SLC13A3