SLC10A2 Antibody

Images

 
Western Blot: SLC10A2 Antibody [NBP1-88813] - Analysis in control (vector only transfected HEK293T lysate) and sLC10A2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: SLC10A2 Antibody [NBP1-88813] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC10A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKAEIPESKENGTEPESSFYKANGGFQPDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC10A2 Protein (NBP1-88813PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC10A2 Antibody

  • Apical sodium-dependent bile acid transporter
  • ASBT
  • IBAT
  • ileal apical sodium-dependent bile acid transporter
  • Ileal Na(+)/bile acid cotransporter
  • ileal sodium/bile acid cotransporter
  • Ileal sodium-dependent bile acid transporter
  • ISBT
  • Na(+)-dependent ileal bile acid transporter
  • NTCP2
  • NTCP2PBAM
  • PBAM
  • SLC10A2
  • Sodium/taurocholate cotransporting polypeptide, ileal
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 2
  • Solute carrier family 10 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35006
Species: Hu
MAB9120
Species: Hu
Applications: ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-80734
Species: Hu
Applications: IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for SLC10A2 Antibody (NBP1-88813) (0)

There are no publications for SLC10A2 Antibody (NBP1-88813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A2 Antibody (NBP1-88813) (0)

There are no reviews for SLC10A2 Antibody (NBP1-88813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A2 Antibody (NBP1-88813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC10A2 Products

Bioinformatics Tool for SLC10A2 Antibody (NBP1-88813)

Discover related pathways, diseases and genes to SLC10A2 Antibody (NBP1-88813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A2 Antibody (NBP1-88813)

Discover more about diseases related to SLC10A2 Antibody (NBP1-88813).
 

Pathways for SLC10A2 Antibody (NBP1-88813)

View related products by pathway.

PTMs for SLC10A2 Antibody (NBP1-88813)

Learn more about PTMs related to SLC10A2 Antibody (NBP1-88813).

Blogs on SLC10A2

There are no specific blogs for SLC10A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A2
Entrez