SLC10A6 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC10A6 Antibody [NBP1-80734] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SLC10A6 Antibody [NBP1-80734] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: SLC10A6 Antibody [NBP1-80734] - Staining in human esophagus and skeletal muscle tissues using anti-SLC10A6 antibody. Corresponding SLC10A6 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC10A6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE
Specificity
Specificity of human SLC10A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC10A6 Protein (NBP1-80734PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC10A6 Antibody

  • MGC129575
  • MGC129576
  • SOATSodium-dependent organic anion transporter
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 6
  • solute carrier family 10 member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60109
Species: Hu
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00201780-P01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-65538
Species: Hu
NBP2-38213
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP2-21601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008940-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-79801
Species: Hu
Applications: WB
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC10A6 Antibody (NBP1-80734) (0)

There are no publications for SLC10A6 Antibody (NBP1-80734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A6 Antibody (NBP1-80734) (0)

There are no reviews for SLC10A6 Antibody (NBP1-80734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC10A6 Antibody (NBP1-80734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC10A6 Antibody (NBP1-80734)

Discover related pathways, diseases and genes to SLC10A6 Antibody (NBP1-80734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A6 Antibody (NBP1-80734)

Discover more about diseases related to SLC10A6 Antibody (NBP1-80734).
 

Pathways for SLC10A6 Antibody (NBP1-80734)

View related products by pathway.

PTMs for SLC10A6 Antibody (NBP1-80734)

Learn more about PTMs related to SLC10A6 Antibody (NBP1-80734).

Blogs on SLC10A6

There are no specific blogs for SLC10A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A6