SLAM/CD150 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human thymus shows strong nuclear and cytoplasmic positivity in cortical and medullary cells.

Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Analysis in human lymph node and testis tissues using Anti-SLAMF1 antibody. Corresponding SLAMF1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human testis shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLAM/CD150 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLAM/CD150 Antibody - BSA Free (NBP2-62662) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLAMF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLAM/CD150 Recombinant Protein Antigen (NBP2-62662PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLAM/CD150 Antibody - BSA Free

• CD 150
• CD150
• CD150IPO-3
• CDw150
• IPO-3
• signaling lymphocytic activation molecule family member 1
• signaling lymphocytic activation molecule
• SLAM
• SLAMCD150 antigen
• SLAMF1

Background

SLAM comes with two antibodies, one against the SLAMF1 protein, and the other against the specific Y281 phosphorylated site of SLAMF1 for use in in situ Proximity Ligation Assay

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLAMF1