SLAM/CD150 Antibody

Images

 
Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human thymus shows strong nuclear and cytoplasmic positivity in cortical and medullary cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Analysis in human lymph node and testis tissues using Anti-SLAMF1 antibody. Corresponding SLAMF1 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: SLAM/CD150 Antibody [NBP2-62662] - Staining of human testis shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLAM/CD150 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLAMF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLAM/CD150 Recombinant Protein Antigen (NBP2-62662PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SLAM/CD150 Antibody

  • CD 150
  • CD150
  • CD150IPO-3
  • CDw150
  • IPO-3
  • signaling lymphocytic activation molecule family member 1
  • signaling lymphocytic activation molecule
  • SLAM
  • SLAMCD150 antigen
  • SLAMF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
AF3327
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
AF1039
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
MAB2555
Species: Mu
Applications: CyTOF-ready, Flow, WB
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
MAB1855
Species: Hu
Applications: WB
MAB19081
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
H00117157-D01P
Species: Hu
Applications: WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NBP2-62662
Species: Hu
Applications: IHC, IHC-P

Publications for SLAM/CD150 Antibody (NBP2-62662) (0)

There are no publications for SLAM/CD150 Antibody (NBP2-62662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLAM/CD150 Antibody (NBP2-62662) (0)

There are no reviews for SLAM/CD150 Antibody (NBP2-62662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLAM/CD150 Antibody (NBP2-62662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLAM/CD150 Products

Bioinformatics Tool for SLAM/CD150 Antibody (NBP2-62662)

Discover related pathways, diseases and genes to SLAM/CD150 Antibody (NBP2-62662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLAM/CD150 Antibody (NBP2-62662)

Discover more about diseases related to SLAM/CD150 Antibody (NBP2-62662).
 

Pathways for SLAM/CD150 Antibody (NBP2-62662)

View related products by pathway.

PTMs for SLAM/CD150 Antibody (NBP2-62662)

Learn more about PTMs related to SLAM/CD150 Antibody (NBP2-62662).
 

Research Areas for SLAM/CD150 Antibody (NBP2-62662)

Find related products by research area.

Blogs on SLAM/CD150

There are no specific blogs for SLAM/CD150, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLAM/CD150 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLAMF1