Skp1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Skp1 Antibody [NBP2-58725] - Staining of human cell line MCF7 shows localization to nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Skp1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Skp1 Recombinant Protein Antigen (NBP2-58725PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Skp1 Antibody - BSA Free

• Cyclin-A/CDK2-associated protein p19
• EMC19p19skp1
• MGC34403
• OCP2
• OCP2OCP-2
• OCP-IIS-phase kinase-associated protein 1A (p19A)
• Organ of Corti protein 2
• Organ of Corti protein II
• p19a
• p19Acyclin A/CDK2-associated p19
• p19Skp1
• RNA polymerase II elongation factor-like protein OCP2
• RNA polymerase II elongation factor-like protein
• SKP1
• SKP1A
• SKP1Acyclin A/CDK2-associated protein p19
• S-phase kinase-associated protein 1
• TCEB1LSIII
• Transcription elongation factor B

Background

Skp1 encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKP1