Skp1 Antibody

Images

 
Western Blot: Skp1 Antibody [NBP2-56707] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Skp1 Antibody [NBP2-56707] - Staining of human cell line MCF7 shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Skp1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Specificity
Specificity of human Skp1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Skp1 Antibody

  • Cyclin-A/CDK2-associated protein p19
  • EMC19p19skp1
  • MGC34403
  • OCP2
  • OCP2OCP-2
  • OCP-IIS-phase kinase-associated protein 1A (p19A)
  • Organ of Corti protein 2
  • Organ of Corti protein II
  • p19a
  • p19Acyclin A/CDK2-associated p19
  • p19Skp1
  • RNA polymerase II elongation factor-like protein OCP2
  • RNA polymerase II elongation factor-like protein
  • SKP1
  • SKP1A
  • SKP1Acyclin A/CDK2-associated protein p19
  • S-phase kinase-associated protein 1
  • TCEB1LSIII
  • Transcription elongation factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-58219
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB6817
Species: Hu
Applications: WB
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-59631
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-65253
Species: Hu
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Skp1 Antibody (NBP2-56707) (0)

There are no publications for Skp1 Antibody (NBP2-56707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Skp1 Antibody (NBP2-56707) (0)

There are no reviews for Skp1 Antibody (NBP2-56707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Skp1 Antibody (NBP2-56707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Skp1 Products

Bioinformatics Tool for Skp1 Antibody (NBP2-56707)

Discover related pathways, diseases and genes to Skp1 Antibody (NBP2-56707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Skp1 Antibody (NBP2-56707)

Discover more about diseases related to Skp1 Antibody (NBP2-56707).
 

Pathways for Skp1 Antibody (NBP2-56707)

View related products by pathway.

PTMs for Skp1 Antibody (NBP2-56707)

Learn more about PTMs related to Skp1 Antibody (NBP2-56707).
 

Research Areas for Skp1 Antibody (NBP2-56707)

Find related products by research area.

Blogs on Skp1

There are no specific blogs for Skp1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Skp1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKP1