SKAR Antibody - BSA Free

Images

 
Western Blot: SKAR Antibody [NBP1-57411] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: SKAR Antibody [NBP1-57411] - Human Skin Tissue, 10ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

SKAR Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to POLDIP3(polymerase (DNA-directed), delta interacting protein 3) The peptide sequence was selected from the C terminal of POLDIP3. Peptide sequence DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLDIP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SKAR Antibody - BSA Free

  • KIAA1649polymerase delta interacting protein 46
  • p46
  • PDIP46S6K1 Aly/REF-like target
  • polymerase (DNA-directed), delta interacting protein 3
  • RNA-binding protein P46
  • SKARpolymerase delta-interacting protein 3,46 kDa DNA polymerase delta interaction protein

Background

POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31164
Species: Hu
Applications: ICC/IF, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87381
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-91214
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB

Publications for SKAR Antibody (NBP1-57411) (0)

There are no publications for SKAR Antibody (NBP1-57411).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKAR Antibody (NBP1-57411) (0)

There are no reviews for SKAR Antibody (NBP1-57411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SKAR Antibody (NBP1-57411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKAR Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol POLDIP3
Uniprot