SIRT6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SIRT6 Antibody [NBP2-56220] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIRT6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL
Specificity
Specificity of human SIRT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRT6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SIRT6 Recombinant Protein Antigen (NBP2-56220PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SIRT6 Antibody

  • EC 3.5.1.-
  • NAD-dependent deacetylase sirtuin-6
  • SIR2L6sir2-related protein type 6
  • SIR2-like protein 6
  • sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 6
  • sirtuin 6
  • sirtuin type 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-52563
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NB100-56372
Species: Hu, Mu, Rt
Applications: WB
NB110-81746
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-1406
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-594
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF6347
Species: Hu
Applications: WB

Publications for SIRT6 Antibody (NBP2-56220) (0)

There are no publications for SIRT6 Antibody (NBP2-56220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRT6 Antibody (NBP2-56220) (0)

There are no reviews for SIRT6 Antibody (NBP2-56220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SIRT6 Antibody (NBP2-56220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SIRT6 Antibody (NBP2-56220)

Discover related pathways, diseases and genes to SIRT6 Antibody (NBP2-56220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRT6 Antibody (NBP2-56220)

Discover more about diseases related to SIRT6 Antibody (NBP2-56220).
 

Pathways for SIRT6 Antibody (NBP2-56220)

View related products by pathway.

PTMs for SIRT6 Antibody (NBP2-56220)

Learn more about PTMs related to SIRT6 Antibody (NBP2-56220).
 

Research Areas for SIRT6 Antibody (NBP2-56220)

Find related products by research area.

Blogs on SIRT6

There are no specific blogs for SIRT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIRT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT6