Sin1/MAPKAP1 Antibody - BSA Free

Analysis in human testis and pancreas tissues using Anti-MAPKAP1 antibody. Corresponding MAPKAP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human pancreas shows low expression as expected.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sin1/MAPKAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sin1/MAPKAP1 Antibody - BSA Free (NBP1-89569) is a polyclonal antibody validated for use in IHC and WB. Anti-Sin1/MAPKAP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPKAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sin1/MAPKAP1 Protein (NBP1-89569PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sin1/MAPKAP1 Antibody - BSA Free

• JC310
• MAPKAP1
• MEKK2-interacting protein 1
• MGC2745
• MIP1
• MIP1SIN1SIN1b
• Mitogen-activated protein kinase 2-associated protein 1
• mitogen-activated protein kinase associated protein 1
• mSIN1
• ras inhibitor MGC2745
• SAPK-interacting protein 1
• Sin1
• SIN1g
• stress-activated map kinase interacting protein 1
• Stress-activated map kinase-interacting protein 1
• stress-activated protein kinase-interacting 1
• target of rapamycin complex 2 subunit MAPKAP1
• TORC2 subunit MAPKAP1

Background

Sin1 is a novel component of the eukaryotic SAPK pathway. Sin1 and the H3 and H4 histones interact genetically, with the C terminus of Sin1 physically associating with components of the SWI-SNF complex. This interaction is blocked by the N-terminal half of the protein in full length Sin1. It has been proposed that Sin1 acts as a regulatable bridge between the SWI-SNF complex and the nucleosome Sin1 is also required for effective transcription via the AP-1 factor Pap1, but does not prevent its nuclear translocation. Sin1 is a novel component of the eukaryotic SAPK pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sin1/MAPKAP1 Antibody (NBP1-89569)(1)

Publication using NBP1-89569

• Hau AM, Gupta S, Leivo MZ, et al. Dynamic Regulation of Caveolin-1 Phosphorylation and Caveolae Formation by mTORC2 in Bladder Cancer Cells Am. J. Pathol. 2019-06-11 [PMID: 31199921]

Bioinformatics

• Gene Symbol: MAPKAP1