Siglec-6/CD327 Antibody

Images

 
Immunohistochemistry-Paraffin: Siglec-6/CD327 Antibody [NBP1-85756] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Siglec-6/CD327 Antibody [NBP1-85756] - Staining of human placenta shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Siglec-6/CD327 Antibody [NBP1-85756] - Staining in human placenta and prostate tissues using anti-SIGLEC6 antibody. Corresponding SIGLEC6 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Siglec-6/CD327 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGT
Specificity
Specificity of human Siglec-6/CD327 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIGLEC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Siglec-6/CD327 Protein (NBP1-85756PEP)
Publications
Read Publication using NBP1-85756.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Siglec-6/CD327 Antibody

  • CD327 antigen
  • CD327
  • CD33 antigen-like 1
  • CD33L1
  • CD33L1OBBP1CD327
  • CD33L2
  • CD33LCDW327
  • CDw327
  • OB-BP1
  • Obesity-binding protein 1
  • sialic acid binding Ig-like lectin 6
  • sialic acid-binding Ig-like lectin 6
  • Siglec6
  • Siglec-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF1668
Species: Hu
Applications: WB, IP
MAB10721
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85756
Species: Hu
Applications: IHC, IHC-P

Publications for Siglec-6/CD327 Antibody (NBP1-85756)(1)

Reviews for Siglec-6/CD327 Antibody (NBP1-85756) (0)

There are no reviews for Siglec-6/CD327 Antibody (NBP1-85756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Siglec-6/CD327 Antibody (NBP1-85756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Siglec-6/CD327 Products

Bioinformatics Tool for Siglec-6/CD327 Antibody (NBP1-85756)

Discover related pathways, diseases and genes to Siglec-6/CD327 Antibody (NBP1-85756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-6/CD327 Antibody (NBP1-85756)

Discover more about diseases related to Siglec-6/CD327 Antibody (NBP1-85756).
 

Pathways for Siglec-6/CD327 Antibody (NBP1-85756)

View related products by pathway.

PTMs for Siglec-6/CD327 Antibody (NBP1-85756)

Learn more about PTMs related to Siglec-6/CD327 Antibody (NBP1-85756).

Blogs on Siglec-6/CD327

There are no specific blogs for Siglec-6/CD327, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-6/CD327 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC6
Entrez