Shugoshin Recombinant Protein Antigen

Images

 
There are currently no images for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Shugoshin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Shugoshin

Source: E.coli

Amino Acid Sequence: SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SGO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP3-17932. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Shugoshin Recombinant Protein Antigen

  • FLJ14230
  • hSgo1
  • NY-BR-85
  • Serologically defined breast cancer antigen NY-BR-85
  • SGO
  • Sgo1
  • shugoshin 1AB protein
  • shugoshin 1CD protein
  • shugoshin 1EF protein
  • shugoshin 1GH protein
  • shugoshin 1KL protein
  • shugoshin-like 1 (S. pombe)
  • shugoshin-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-87144
Species: Hu
Applications: IHC, IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-26626
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NB100-2518
Species: Hu
Applications: Flow-IC, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-92579
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP) (0)

There are no publications for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP) (0)

There are no reviews for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Shugoshin Products

Bioinformatics Tool for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP)

Discover related pathways, diseases and genes to Shugoshin Recombinant Protein Antigen (NBP3-17932PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP)

Discover more about diseases related to Shugoshin Recombinant Protein Antigen (NBP3-17932PEP).
 

Pathways for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP)

View related products by pathway.

PTMs for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP)

Learn more about PTMs related to Shugoshin Recombinant Protein Antigen (NBP3-17932PEP).
 

Research Areas for Shugoshin Recombinant Protein Antigen (NBP3-17932PEP)

Find related products by research area.

Blogs on Shugoshin

There are no specific blogs for Shugoshin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Shugoshin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SGO1