Shugoshin Antibody (4G6)

Images

 
Western Blot: Shugoshin Antibody (4G6) [H00151648-M02] - Analysis of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Shugoshin Antibody (4G6) [H00151648-M02] - Detection limit for recombinant GST tagged SGOL1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Shugoshin Antibody (4G6) Summary

Immunogen
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Specificity
SGOL1 - shugoshin-like 1 (S. pombe)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Shugoshin Antibody (4G6)

  • FLJ14230
  • hSgo1
  • NY-BR-85
  • Serologically defined breast cancer antigen NY-BR-85
  • SGO
  • Sgo1
  • shugoshin 1AB protein
  • shugoshin 1CD protein
  • shugoshin 1EF protein
  • shugoshin 1GH protein
  • shugoshin 1KL protein
  • shugoshin-like 1 (S. pombe)
  • shugoshin-like 1

Background

Shugoshin (Sgo) proteins constitute a conserved protein family defined as centromeric protectors of Rec8-containing cohesin complexes in meiosis. It has been demonstrated that vertebrate shugoshin is required for preserving centromeric cohesion during mitosis. The presence of human Scc1 at centromeres in mitosis is dependent on human Sgo1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-87145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-26626
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NB100-2518
Species: Hu
Applications: Flow-IC, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DY8198-05
Species: Hu
Applications: ELISA
NBP1-92579
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Shugoshin Antibody (H00151648-M02) (0)

There are no publications for Shugoshin Antibody (H00151648-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shugoshin Antibody (H00151648-M02) (0)

There are no reviews for Shugoshin Antibody (H00151648-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Shugoshin Antibody (H00151648-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Shugoshin Products

Bioinformatics Tool for Shugoshin Antibody (H00151648-M02)

Discover related pathways, diseases and genes to Shugoshin Antibody (H00151648-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shugoshin Antibody (H00151648-M02)

Discover more about diseases related to Shugoshin Antibody (H00151648-M02).
 

Pathways for Shugoshin Antibody (H00151648-M02)

View related products by pathway.

PTMs for Shugoshin Antibody (H00151648-M02)

Learn more about PTMs related to Shugoshin Antibody (H00151648-M02).
 

Research Areas for Shugoshin Antibody (H00151648-M02)

Find related products by research area.

Blogs on Shugoshin

There are no specific blogs for Shugoshin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Shugoshin Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SGO1
Entrez
OMIM
Uniprot