Home » Shugoshin » Shugoshin Antibodies » Shugoshin Antibody (4G6)

Shugoshin Antibody (4G6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Shugoshin Antibody (4G6) [H00151648-M02] - Analysis of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.
Western Blot: Shugoshin Antibody (4G6) [H00151648-M02] - Analysis of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: Shugoshin Antibody (4G6) [H00151648-M02] - Detection limit for recombinant GST tagged SGOL1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Shugoshin Antibody (4G6) Summary

Immunogen
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Specificity
SGOL1 - shugoshin-like 1 (S. pombe)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Shugoshin Antibody (4G6)

  • FLJ14230
  • hSgo1
  • NY-BR-85
  • Serologically defined breast cancer antigen NY-BR-85
  • SGO
  • Sgo1
  • shugoshin 1AB protein
  • shugoshin 1CD protein
  • shugoshin 1EF protein
  • shugoshin 1GH protein
  • shugoshin 1KL protein
  • shugoshin-like 1 (S. pombe)
  • shugoshin-like 1

Background

Shugoshin (Sgo) proteins constitute a conserved protein family defined as centromeric protectors of Rec8-containing cohesin complexes in meiosis. It has been demonstrated that vertebrate shugoshin is required for preserving centromeric cohesion during mitosis. The presence of human Scc1 at centromeres in mitosis is dependent on human Sgo1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Separase Antibody
(6H6)
H00009700-M01
Western Blot: Separase Antibody (6H6) [H00009700-M01] - ESPL1 monoclonal antibody (M01), clone 6H6 Analysis of ESPL1 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: Separase Antibody (6H6) [H00009700-M01] - Analysis of monoclonal antibody to ESPL1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
(9 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Rad21 Antibody
NBP2-20053
Western Blot: Rad21 Antibody [NBP2-20053] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Rad21 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP2-20053] - Mouse testis. Rad21 stained by Rad21 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP2-20053] - Rat kidney. Rad21 stained by Rad21 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(1 Review)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot: PLK1 Antibody (OTI1D4) [NBP1-48291] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PLK1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PLK1.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-PLK1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-PLK1 mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Bub1 Antibody
H00000699-D01P
Proximity Ligation Assay: Bub1 Antibody [H00000699-D01P] - Analysis of protein-protein interactions between BUB1 and APC. HeLa cells were stained with anti-BUB1 rabbit purified polyclonal 1:1200 and anti-APC mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Bub1 Antibody [H00000699-D01P] - Analysis of antibody to BUB1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Bub1 Antibody [H00000699-D01P] - Analysis of BUB1 expression in Jurkat.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
PPP2R4 Antibody
NBP1-87232
Western Blot: PPP2R4 Antibody [NBP1-87232] - Analysis in human cell line SiHa.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SGOL2 Antibody
NB100-60454
Immunoprecipitation: SGOL2 Antibody [NB100-60454] - Detection of Human SGO2 by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-SGO2 antibody NB100-60454 used for IP at 3 mcg/mg lysate. SGO2 was also immunoprecipitated by rabbit anti-SGO2 antibody NB100-60455, which recognizes a downstream epitope. Detection: Chemiluminescence with an exposure time of 3 minutes.
(2 Publications)
Species: Hu
Applications: IP, WB (-)
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/Immunofluorescence: Aurora B Antibody - BSA Free [NB100-294] - HeLa human cervix epitheloid carcinoma cells were fixed and permeabilized with 4% paraformaldehyde followed by cold methanol. Fixed cells were stained with 1:50 Anti-Aurora B antibody produced in rabbit. The antibody was developed using Anti-Rabbit IgG (whole molecule)-FITC antibody produced in goat.
Western Blot: Aurora B Antibody - BSA Free [NB100-294] - Whole extract of PC-12 cells were separated on SDS-PAGE and probed with Anti-Aurora B antibody produced in Rabbit. The antibody was developed using 1:10,000 Anti-Rabbit IgG (whole molecule)-Peroxidase antibody produced in Goat.Lanes:1. 1:1000 antibody2. 1:2000 antibody3. Negative Control
(5 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
REC8 Antibody
NBP1-87145
Immunocytochemistry/Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAD2L1 Antibody
NB100-563
Immunohistochemistry: MAD2L1 Antibody [NB100-563] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- MAD2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MAD2L1 Antibody [NB100-563] - Detection of human MAD2L1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MAD2L1 antibody NB100-563 (lot 3) used for IP at 3 ug/mg lysate. MAD2L1 was also immunoprecipitated by a previous lot (lot 2) and by rabbit anti-MAD2L1 antibody NB100-564. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(14 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
GSG2 Antibody
NBP1-26626
Western Blot: GSG2 Antibody [NBP1-26626] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Haspin antibody used for WB at 0.04 ug/ml (A) and 1 ug/ml (B) and used for IP at 10ug/mg lysate. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 10 seconds (B).
Immunohistochemistry-Paraffin: GSG2 Antibody [NBP1-26626] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-Haspin used at a dilution of 1:200 (1ug/ml). Detection: DAB
Species: Hu
Applications: IHC, IHC-P, IP, WB
DEP-1/CD148
Antibody (143-41)
MAB1934
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Human DEP‑1/CD148 Monoclonal Antibody (Catalog # MAB1934) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DEP‑1/CD148 at approximately 220 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
HP1 alpha Antibody
NB100-2518
Flow (Intracellular): HP1 alpha Antibody [NB100-2518] - Analysis using the Alexa Fluor 488 conjugate of NB100-2518. Detection of HeLa cells (1 x 10^6 cells/mL) with HP-1 antibody (orange) stained at 1:500. Shown with rIgG (AF488) isotype control (blue).
Immunocytochemistry/Immunofluorescence: HP1 alpha Antibody [NB100-2518] - HP1 alpha antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Western Blot: HP1 alpha Antibody [NB100-2518] - Detection of HP 1 alpha in HeLa whole cell lysate using NB100-2518.
Species: Hu
Applications: Flow-IC, ICC/IF, WB
INCENP Antibody
(3D2) - BSA Free
NBP2-37471
ELISA: INCENP Antibody (3D2) [NBP2-37471] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: INCENP Antibody (3D2) [NBP2-37471] - Analysis using INCENP mAb against human INCENP recombinant protein. (Expected MW is 50.2 kDa)
Western Blot: INCENP Antibody (3D2) [NBP2-37471] - Analysis using INCENP mAb against HEK293 (1) and INCENP (AA: 369-583)-hIgGFc transfected HEK293 (2) cell lysate.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
alpha-Defensin 1
[Biotin]
DY8198-05
(3 Publications)
Species: Hu
Applications: ELISA
WAPL Antibody
NBP1-92579
Western Blot: WAPL Antibody [NBP1-92579] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human colon, lymph node, skin and testis using Anti-WAPL antibody NBP1-92579 (A) shows similar protein distribution across tissues to independent antibody NBP1-92578 (B).
Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human colon.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
MIS12 Antibody
NB100-2359
Immunohistochemistry: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by immunohistochemistry. Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-MIS12 (NB100-2359). Detection: DAB
Immunoprecipitation: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MIS12 antibody NB100-2359 used for IP at 3 ug per reaction. MIS12 was also immunoprecipitated by rabbit anti-MIS12 antibody NB100-2358. For blotting immunoprecipitated MIS12, NB100-2359 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: MIS12 Antibody [NB100-2359] - Detection of human MIS12 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MIS12 antibody NB100-2359 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Publications)
Species: Hu
Applications: IHC, IP, WB
BubR1 Antibody
(8G1) - BSA Free
NB100-353
Flow Cytometry: BubR1 Antibody (8G1) [NB100-353] - An intracellular stain was performed on HeLa cells with BubR1 Antibody (8G1)NB100-353C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 650.
Immunocytochemistry/Immunofluorescence: BubR1 Antibody (8G1) [NB100-353] - Immunofluorescence of an asynchronous cycling population of human cells (U2OS) with NB100-353. No signal is detected from interphase cells, whereas cells undergoing mitosis accumulate BubR1 at the kinetochores. Image reveals kinetochores at prometaphase. Image courtesy of Luke Hughes-Davies and Rhiannon Jade, Gurdon Institute, Cambridge, UK.
Western Blot: BubR1 Antibody (8G1) [NB100-353] - BUBR1 detected in HeLa cell lysate using NB 100-353.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
MAD1L1/MAD1
Antibody
NBP1-32775
Immunohistochemistry-Paraffin: MAD1L1/MAD1 Antibody [NBP1-32775] - Paraffin-embedded SW480 Xenograft, using antibody at 1:100 dilution.
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - Sample (30 ug of whole cell lysate) A: Molt-4 7.5% SDS PAGE diluted at 1:10000
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat 2 whole cell lysate/extract 7.5% SDS-PAGE MAD1 antibody dilution: 1:3000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Knockdown Validated: Survivin Antibody [NB500-201] - Anti-tumor effects and functional evidence of sCA-survivin-siRNA in HCT116 and HT29 solid tumor models. Immunostaining of survivin in the tumor tissues on day 19 using [NB500-201]. Scale bar, 50 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0116022) licensed under a CC-BY licence.
(22 Reviews)
(355 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Shugoshin Antibody (H00151648-M02) (0)

There are no publications for Shugoshin Antibody (H00151648-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shugoshin Antibody (H00151648-M02) (0)

There are no reviews for Shugoshin Antibody (H00151648-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Shugoshin Antibody (H00151648-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Shugoshin Products

Bioinformatics Tool for Shugoshin Antibody (H00151648-M02)

Discover related pathways, diseases and genes to Shugoshin Antibody (H00151648-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shugoshin Antibody (H00151648-M02)

Discover more about diseases related to Shugoshin Antibody (H00151648-M02).
 

Pathways for Shugoshin Antibody (H00151648-M02)

View related products by pathway.

PTMs for Shugoshin Antibody (H00151648-M02)

Learn more about PTMs related to Shugoshin Antibody (H00151648-M02).
 

Research Areas for Shugoshin Antibody (H00151648-M02)

Find related products by research area.

Blogs on Shugoshin

There are no specific blogs for Shugoshin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Shugoshin Antibody (4G6) and receive a gift card or discount.


Bioinformatics

Gene Symbol SGO1
Entrez
OMIM
Uniprot